SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013434 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013434
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily UBA-like 0.0000000221
Family TAP-C domain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013434   Gene: ENSONIG00000010683   Transcript: ENSONIT00000013444
Sequence length 257
Comment pep:novel scaffold:Orenil1.0:GL831134.1:12127031:12134279:-1 gene:ENSONIG00000010683 transcript:ENSONIT00000013444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNKLKSSQKDKVRQFMIFTQSSEKTAVTCLAQNDWKLDVATDKFFQSPELYISNLKGALD
KKKLEQLYNRYRDPHDDNKIGIDGIQQFCDDLGLDPASISVLLIAWKFRAATQCEFSKQE
FMEGMTEQGCDSIEKLKAQLPKIEQELKDSRKFKDFYQFTFNFAKNPGQKGLDLEMAIAY
WNLVLPGRFKFLDLWNKFLVEHHKRSIPKDTWNLLLDFSTMITDDMSNYDEEGAWPVLID
DFVEFARPHIGTKSTAV
Download sequence
Identical sequences I3JX39
ENSONIP00000013434 ENSONIP00000013434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]