SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013927 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013927
Domain Number 1 Region: 110-236
Classification Level Classification E-value
Superfamily LigT-like 0.000034
Family Atu0111-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013927   Gene: ENSONIG00000011063   Transcript: ENSONIT00000013937
Sequence length 278
Comment pep:novel scaffold:Orenil1.0:GL831139.1:5516735:5521346:1 gene:ENSONIG00000011063 transcript:ENSONIT00000013937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVGYSSSSEDDGEAGGEAEGDKNQSETTCRKCQEEDDGLPTRKKPKTEEEGPKSRLPLP
GCVLAMFPDEVDSQTEDSSLHGGRIRSFKHERGNWASYIYFPYHPEEEFGELLDGILSAA
GARGVVLTAQDEFHLSLSQTVVLRHHWIQPFTQSLKSSLTGCKRFVCSAGRLRVYSNAEK
TRTFLGMEVSTGHAQLLDLIRTVDRTMTEFRLETFYKDPSFHVSLAWCVGDQTVQMEECM
QELQSLVDDHEDGPFVLRLDCSELRCRTGNKTFRFPLE
Download sequence
Identical sequences I3JYI2
ENSONIP00000013927 ENSONIP00000013927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]