SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000013973 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000013973
Domain Number 1 Region: 173-421
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-94
Family Eukaryotic proteases 0.0000619
Further Details:      
 
Domain Number 2 Region: 78-180
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000111
Family Hepsin, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000013973   Gene: ENSONIG00000011100   Transcript: ENSONIT00000013983
Sequence length 422
Comment pep:novel scaffold:Orenil1.0:GL831303.1:225269:231040:-1 gene:ENSONIG00000011100 transcript:ENSONIT00000013983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTPVLTVALAHRLVRLLAAVCAVGLLGGLVVGVWFLVKLLLRPSSSQSPVGLGDTKETSF
CNVTEDISASDSRKGSVFYRISPENSLLEIQLGKLPTWLPVCYERWNSSLGTLVCRQLGY
LRLTKHKGVNLTDIGPNYTDGFIQITSEQKSSLENMWQFRRSCITGKVIALQCFECGTRA
KLPRIIGGVEAALGRWPWQVSLYYSNRHTCGGSIITSQWVVTAAHCVHNYRLPQISSWVV
YAGIVTRSSAKTAQHAGYAVEKIIYNKNYNHRTHDSDIALMKLRTPFNFSDTIRPICLPQ
YDYALPGGTQCWISGWGYTQPDGVHSPDTLKEAPVPIISTKKCNSSCMYNGEITARMLCA
GYTEGKVDACQGDSGGPLVCQDDNVWRLVGVVSWGTGCAEPNHPGVYTKVAKFLGWIYEM
IE
Download sequence
Identical sequences I3JYM8
ENSONIP00000013973 ENSONIP00000013973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]