SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014156 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000014156
Domain Number - Region: 285-484
Classification Level Classification E-value
Superfamily Tropomyosin 0.0019
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number - Region: 106-185
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0732
Family Hemolysin E (HlyE, ClyA, SheA) 0.076
Further Details:      
 
Domain Number - Region: 451-559
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0978
Family Spectrin repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014156   Gene: ENSONIG00000011249   Transcript: ENSONIT00000014166
Sequence length 604
Comment pep:novel scaffold:Orenil1.0:GL831314.1:337989:356496:1 gene:ENSONIG00000011249 transcript:ENSONIT00000014166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQRPPSSMGRPMSRSGSVVPGAGRPPTAIQPPPTAMRVATGMVPGTSAHPGLRGGIPV
ATPGVLTAQIKVTDRPVTQQGLSGMKTGMKGPQRQILDKSYYLGLLRSKINELTTETSKL
HKEIESYNQENSVYLSYEKRAEGLAAEIKDMQGQLADYNMLVDKLNTNTEMEEMINDYNI
LKAENDSEAESIDNIFTERREREEAIGAIEEEIRRERRVADEVVQAMPAAKQEKYFTMTT
TNEELLQELTVLQEELDVLITRKEDYEAELSHSQIKQEVVRLHETLSALEAKRDTMEAEQ
KSLGSPQEEREKLFKQVKEDNQEIASMERQLTEIRDRTRQITEEIRHLEQDSEAAQGECQ
QKYKELKRKEEEIDRFLESFEESRAQEEERLKQGQENIVSLLEHCSRNMLRLRQVDTVTA
SELRNMQEVLVSKETEVVQSESTARGLTTESQRLQQDLEKVQQLEGKITGELSTLQERVS
TMQSELHTYRDLDTLRLTAEEKKKRLQEEQVSLTQRRDAFGQLLEEMNQEYEALKTKLQE
NETHAQLANLERKWQHLEQNNFVMKEFIASKSQESDYASVAKNVSQQVADYNKSLIELLQ
NNTG
Download sequence
Identical sequences I3JZ61
XP_005460238.1.78416 XP_013119757.1.78416 ENSONIP00000014156 ENSONIP00000014156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]