SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014273 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014273
Domain Number 1 Region: 710-815
Classification Level Classification E-value
Superfamily SRCR-like 9.81e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000883
Further Details:      
 
Domain Number 2 Region: 215-607
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 3.53e-34
Family Soluble quinoprotein glucose dehydrogenase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014273   Gene: ENSONIG00000011341   Transcript: ENSONIT00000014284
Sequence length 822
Comment pep:novel scaffold:Orenil1.0:GL831417.1:134310:148848:1 gene:ENSONIG00000011341 transcript:ENSONIT00000014284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERRYFNLSNETNIGFQAWAVMERCCGKITSHLWLWSTLSFLTLCFAPVMLHPQCLDFKPP
FRPQRELEFCIMYKEFGCCDYQKDQELMSKYYQIMDNFDYSGYASCAGFIFDLLCQECSP
YAAHLFDAEDPSTPLRTIPGLCSEYCFQFWNKCSFTIPFLSGDPHIANVRENQTSLCHYL
ELQDKDYCYPYLLNNQRLTQNLGGIQVNSNGCLQLCLEEVANGLQNPLAMVHANDGTHRF
FVAEQVGLVWTYLPDRSKLERPFLNITQVVLTSSWEGDERGFLGLAFHPKYKYNGKLYVY
YSVEVGFDERIRISEFHVSANDMNEVDHSSERVILEIDEPASNHNGGQLLFADDGYLYIF
TGDGGMAGDPFGKYGNAQNKSALLGKVLRIDVDDNQRGPLYRIPPDNPFIHEQGARPEVY
AYGVRNMWRCSVDRGDPWTKDGKGRIFCGDVGQNKFEEIDIIEKGRNYGWRAKEGFSCYD
KKLCANSSLDDVLPVYAYPHKMGKSVTGGYVYRGCEYPNLNGIYIFGDFMSGRLMSLQED
KKTGNWKYNEICMGVGLTCAFPGLINNYHQYIISFAEDESGELYFMSTAIPSATSPSGVV
YKVIDPSRRAPPRQCHYDPLPVRVKSNLIKFVPQETLVGIDLANENFDQQSTESYQWRQE
LSDHLGKLEASLTTPVPARGTSKPTKNSRRKDRRRKNKSKLESVPHIQKGAVRLAGDARN
DRGRVEIYINGEWGTVCDDLWTLVNAGVVCRQLGFQHALKAAKNSEFGEGKDLRILLDDV
QCVGTESSLLDCRHAGVGTHNCAHYEDAGVICGNSSYVADVA
Download sequence
Identical sequences I3JZH8
ENSONIP00000014273 ENSONIP00000014273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]