SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014343 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014343
Domain Number 1 Region: 689-717
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000942
Family Ran binding protein zinc finger-like 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000014343
Domain Number - Region: 11-50
Classification Level Classification E-value
Superfamily UBA-like 0.0281
Family CUE domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014343   Gene: ENSONIG00000011396   Transcript: ENSONIT00000014354
Sequence length 719
Comment pep:novel scaffold:Orenil1.0:GL831259.1:1904788:1936669:1 gene:ENSONIG00000011396 transcript:ENSONIT00000014354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGSHQIDIQVLHDLRQKFPEVPEGVVSQCVLQNNNNLDACCEYLSQVSPGYLYSEEGN
LSFSDDPSFSRLHNHMTQLNLDLQPQNVHVGPVRDSLRMNGSRTLAHSLSEGPLSTGQAT
NSDFFQQEPQSAPVQVPSNFNVFGVMEPPRKPQPPQHLGLYPLGGKATAMGSQQTPRFNP
ITVTLAPNIQTGRNTPTSLHIHGGPQSGLSSPQGNSIYIRPYVSQSGTTRQNQQQGGRAQ
YSPTSQPQQQIYQISHPSSLSGSWSGTQHSSSSSHTSQPQTQGHQTSHVYMPISSPTNPQ
APSFLPTGIMPSSLSAISQYNIQNISTGPRKNQIEIKLESPQRSNSATAVLRTSSGPRSS
STSSCPSSSSSSAGAASVPATPLSIGGSGPTVYISTAATTPSEEVIVASAGSRPQSKLGR
SPHTLFISTNPSLQGPSGARNIGGQVSMGPAYIHHHPPKSRPSVGGGGTASSPRVVVTQP
NTKYTFKITVSPNKPPAVSPGVVSPTFDINNLLGLPQDHHFVETDPQHLSDPLSPHRERQ
SEPRRLSMGSDDAAYTQALLVHQKARMERLWHELEMKKKKLEKLKEEVNEMENDLTRRRL
ERSNSASQIPSIDEMKQLRSQNRSLQIDIDCLSKEIDLLQTKGPHFNPGAIHNFYDNIGF
LGPVPPKPKGTLSIDTGSKSVKPITDQEDEGTQWSCTACTFLNHPALIRCEQCDFPRNF
Download sequence
Identical sequences I3JZP8
ENSONIP00000014343 ENSONIP00000014343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]