SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014366 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014366
Domain Number 1 Region: 384-476
Classification Level Classification E-value
Superfamily Prefoldin 0.00000732
Family Prefoldin 0.013
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000014366
Domain Number - Region: 158-338
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00191
Family HBL-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014366   Gene: ENSONIG00000011415   Transcript: ENSONIT00000014377
Sequence length 509
Comment pep:novel scaffold:Orenil1.0:GL831167.1:97746:100907:-1 gene:ENSONIG00000011415 transcript:ENSONIT00000014377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAKKPKNSDKSAASSQEDAPKKSQKSSHNGASSPGPQGSPRSGSCLSLLVTTVFYMALI
GAAGFAAFHVQQVLDEVRQTNAKHEESARQSAELSGKVESVVQQVESLRGVVDGLESSLG
ITRVELEGAISRMKRGEVETRRVEEALQRLQNDLLRDLSEGINEVKEAREKDFSSLEKTI
EERLAEASQSIKASVAEFTDAQTEAQSQLADLKARLGDIEDPALIKQELSAIVDAVAEIK
TAKDAADSSGDSLRQQISAVREELQTRNREVASVSQEIETVRKVMQDTTGNLRETLSSTE
ASLQALKDKAVMLESGMEQFVGSVRNVEEQVNEAATQALLRTDDLAARVKASEENVVSMS
ASVSDINSKVQSLFDKHDAHESSLAAQGKAVEDIKSNLEQELEAVKSSLEDLQSSIAALE
GDKTELPSTDSSLGEQVEDLEKRLAALEDNSSRMKPEQLENLRDMVAGLESKAAKLEGHD
QAIAALQEALQKTTESLAGLSEQPDITEE
Download sequence
Identical sequences I3JZS1
ENSONIP00000014366 ENSONIP00000014366 XP_005451645.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]