SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014378 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014378
Domain Number 1 Region: 535-645
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 352-475
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-16
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 3 Region: 653-719
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000498
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 712-774
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000389
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 779-839
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000017
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 298-360
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000661
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 184-299
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000379
Family Spermadhesin, CUB domain 0.0085
Further Details:      
 
Domain Number 8 Region: 474-533
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000025
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014378   Gene: ENSONIG00000011425   Transcript: ENSONIT00000014389
Sequence length 935
Comment pep:novel scaffold:Orenil1.0:GL831139.1:8140439:8251891:1 gene:ENSONIG00000011425 transcript:ENSONIT00000014389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPAACSVDYRLRCVLPAVLWIGLMWSSVSTADKEVSTIMPSARSPVLPSRSTKQGSPKE
KHSSAVTGGLQQSVLAQKGQLVSQKGGILPSALPQNLLPLLGRGLSINHTPEHQSRGLPK
RVKSPASTAASGQGSSTSQPLPTDAHSRMPHTERHTPEQEAEITTVSMMPDLDAEIESTS
AAASSCMVIFTDPEGYIDSSDDPPLPDGTFLRCTYTVTVYTGYGVELQVKSVNLSDGEQL
SITGVDEHGSLLVLANHTLLVEGQVIRSPTNTLSVYYCSGLEGSMGIFQLHYQIFRLSCS
LPKRPHFGDVSVLDLLPGGTARFHCHMGYHLHGEPVLTCLNASLPVWSDKEPVCRALCGG
TVKNATVGRVLSPSPHHGPNATLDRSCSWSLEAPKDQRLHLHLERLALGPTDRLVLWSGL
DAGSVVLFDSGRGGQIPFEGVISEGPAVRIQFITDQPNHNTGFNIRYEAFERGHCYEPYL
QNGNFTTSDPLYGVGTVVQFTCDPGHSLEQGPPVIECISARDPYWNDTEPLCKAQCGGDL
SGPGGLILSPNWPEWYGEGEDCSWRIHVGEDKRVLLDVQLLNISDSDMLTITDGDEVTTR
ILGRYVGGSSPFKLSSTTPDLTVTFHSDPAGLVFGKGEGFIINYIEVSRNDSCPDLPEIQ
NGWKTTSHVALVRGACITYQCDPGYDLVGRETLTCQLDLSWSSQPPFCEKIMYCSDPGHV
EHATRSLSDPKLLVGTTIQYSCNTGFILQGGATITCYGREPGTPVWTSHLPHCVSEDSVS
CENPGVPDNGYQILSKRLYLPGESLTFVCYQGYELIGEVAIKCILGNPSFWSGPLPLCRA
NQDCFGNHALEVAEATAGSPLNGGNIALAIFILILLLSVLLGGVYVYVTRCRYNSNLRLP
LIYPHPYRQITVETEFDNPLYETGGQDTREYEVSI
Download sequence
Identical sequences I3JZT3
XP_005449519.1.78416 ENSONIP00000014378 ENSONIP00000014378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]