SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014407 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014407
Domain Number 1 Region: 1213-1433
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-27
Family Kelch motif 0.0058
Further Details:      
 
Domain Number 2 Region: 26-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-25
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1746-1878
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000157
Family Growth factor receptor domain 0.004
Further Details:      
 
Domain Number 4 Region: 924-973
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 5 Region: 165-283,342-422
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000458
Family Galactose oxidase, central domain 0.022
Further Details:      
 
Domain Number 6 Region: 1010-1115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000693
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000014407
Domain Number - Region: 1916-1953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family Laminin-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014407   Gene: ENSONIG00000011447   Transcript: ENSONIT00000014418
Sequence length 2396
Comment pep:novel scaffold:Orenil1.0:GL831458.1:329065:349567:-1 gene:ENSONIG00000011447 transcript:ENSONIT00000014418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVMASPLPVSFILVVLLLAESLVCQTGACKGHRQVLRGPPGYVTDGAGNYSVNGNCEWLI
KAPSNSHRIVLNFTFMDTECTYDYLFVYDGDSYQSPLLASLSGNTVPQPIEAKSGKMLLH
LFSDANYHLLGFNATYTFSLCPGACGGHGPCSVNGQCDKVRVGIGXALGDLIKYNFTSNQ
WESRSYGHSPVSEHTQTSIAFALSFSMQTSVQVTVSTLQRMDSKISTPRFSLNDLSGPSL
SFDNQELRYIKTHKLIVSVLFYIYKNNLKDNSITIVIGLKAKPITITYNFMLFFSFGGSS
DIHLLMAIYYNSLNLCNIIHKRLADMQRSARILKGHHLVLKFPSLGFNVCLAGGNVHIHY
LEEKCYDEEIFFYHLGCHQWVSAKEKLEGGDAMRGRYSHVAAVMEGRVLLVAGGYSGVAR
GDLVAYKVPLFVSSDQGDRHQDAVCAEAVDESMCLKNPECSWCEGRCREYQPTNPSQCGS
TGCLGLARFLSDCQSCLVFSGTPASLARAPGEFGWCVQNESCLPVSERSACRVDQISGAY
GWWGERTLFLTSLHSCRTENYVPGLHLLTFHHPRNDSQPDQVRSPNVLILPVEPVTTSLS
AYTYSSFLPPILHSSLDIMILHMAATLNEKGESESSNETDETELEVVGRWAAPQEKELKL
LARPDGSRLFSNLTRGNHYLVQAEGYLNNSGSGQTSEMALIWNRTLPEGNEINFLFLEPY
RSGSFIQTSAAHLFYCTITFFYRRKTCGECLSNSSQCAWCESAQACFYFAAYLTKYPYGQ
CRDWYDSYYNNICCNDYNHFLSQSVSQSNCTVGLRLHNWLLHFKTVLTVFLSNWAPASTC
LIYNLLLTVTNGNYGHITHRLTTPLEFKLQLSPHNQMNKNTRNNTFRFCQTVSVHSVPQC
KQCSALNTCTECLRTFQCGXCVPCECNGHGDPLQGYCHNQTGQCYCTHNTQGPHCESCLP
GYYGDPRNNGTCYRQCQGRSVLLSSTSSTTIPLSSSLGWLSGTEGKGGLSHCLWVLSVTE
NLAPCLPRQFCPPVALTLHPDSHTHCKSSYVYVFDGLPRFLGNGVVHSDHNLIGAFCGTT
RTQPITVEATSGVISVYFEANVTSDRPQGFNASFWVRRCQQSSEDEDGSVCPGGAQCQGG
LCQCPQGYGGPHCDRLVCPQDCGIAEGRGTCNISLGVCVCSESWVGSDCSIPRDFNSLVW
ETLLDAQMTVNQAHRFLHRMGHSLVSGPQGNLWMYGGLSLTEGILGNVYSYKCLDKGLSV
LLIGGYSPENGFNHHLLEFSPQSGNWTIAPHTGTPPTGLYGHTAVYHEQTDAIYVFGGYR
FHVESVEPSAELYSLYYPNLTWSLLATSQGIKPLSRFFHAAALIKDTMVIVGGRTEAEDY
SNSVSLYQINCNTWIQPVFLLVSAVGDPVNGSVSLAMTSWGGRLFLSGGFNGVTLGRLLT
LSVPSDPCALLPTPEACNTTTGSCIWCRGSCASSDTAERMGCFTGQSPCSPTPREPDQCR
RLKTCSECLARHPKTFSSPSQPVLQCKWCTNCPEGACISSSLSCTAVHDCRINQREIFLS
SNCTETSCEASDCPKCTASGKCMWTRQFKRTGETRRILSVNPTYDWTCFSYALLNVSPMQ
VESSPPLPCPPPCHSLHNCSLCLSSNGSDGGWQHCVWSMALQRCMSPSFVPLRCEAGQCG
RLLSRGDSCSPQCSQLTQCSQCIARPQCGWCSSRGGNGAGRCLQGGLDGVSEGVCRLTNS
SWSFLHCPEEDECANGHHNCNSTQDCHDLPQGYHCTCKQGYILSSVSGQCEPVCAQGCVN
GTCTSPGVCQCHFGFVGDNCSSQCSCNKHSNCAGVNKPDVCLECHNNTMGKHCEKCKPLF
VGSAKGGGTCHPCREFCKGNSAVCLSRDELKKAQDNPQLFPLDPNSIQSWVSEGPTEENA
VCVNCQNNSVGDRCESCLSGYFLLQGKCEKCQCNGHADTCNEHDGTGCPCQNNTETSSCL
SSPQSDRKDCYRQQCAKCKDSFNGTPVNGRQCYRQFNVDTECCFDPTSQTNCFHDPTIRN
LPKGRTVFFAAQPKFTNVDIRVTIDVTFGEVEVYVSNSHDTFIVDVDRYTGIHTIKIEEE
SVVPGKTAGTEKDSPPSPIKVFANTSSSFAGSVLSQSLQAKPPGAEREIREERAEGLITY
ITVWKPQTVLIVRGVRDRVVITFPHEVHSLKSSRFYIALRGVGTEERQGESQGLLFLRQD
QAHIDLFVFFSVFFSCFFLFLSVCVLLWKVKQFLDFRREQRRHIQEMTKMASRPFAKLTI
YLEPEEPQLIYLPSSGGGVGGSTVSLAHARTSKSSFKVGPITLEPTDDGMAGVATVLFQL
PGGVLAPNRACLGSALVTLRQNLQEYCGHGNGGGHPGAGAGRKGLLGHQHLTTMAM
Download sequence
Identical sequences I3JZW2
ENSONIP00000014407 ENSONIP00000014407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]