SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014585 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014585
Domain Number 1 Region: 31-191
Classification Level Classification E-value
Superfamily RUN domain-like 1.23e-45
Family RUN domain 0.0000399
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000014585
Domain Number - Region: 254-319
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014585   Gene: ENSONIG00000011581   Transcript: ENSONIT00000014596
Sequence length 447
Comment pep:novel scaffold:Orenil1.0:GL831456.1:479053:489603:1 gene:ENSONIG00000011581 transcript:ENSONIT00000014596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FASRAASSWMEQAAMAMGDVSKKASTRNLAVERKNLLTVCRFSVKTLLEKYTAEPIDDSS
EEFVNFAAILEHILSHRFKGSSSWFDGQRSYWDYIRLACAKIPNSCISSIESMENISTSR
AKGRAWMRVALMEKRLSEYIATALRDSRTTKRFYAEGAIMLREEATVLTGMLIGLGAIDF
SFCLKGEALDGKSPAVIDYTPYLKFTQSYDYLSDDDDQQSVDSSASDDSVPEHPYIPLVT
DEESWSTKCRKMEQRFKIVNAQKGYLEELVRLRESQLKNTETENKRLKARLEELQTQSQQ
EKRELEAIVLELQEQLTSLIPCDSNHLAKNLSIPLINQWPTLEPFDRSASRLDMVNLYRK
HFVSFIARSFPSTELLSVEVSLDSDSQRTQEKQNGRAWCTEKDYTPSMMGLCGSLASFPS
CKSLTSLKSSECLVNISTENSPALSPS
Download sequence
Identical sequences I3K0E0
ENSONIP00000014585 ENSONIP00000014585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]