SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014730 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014730
Domain Number 1 Region: 119-314
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.47e-60
Family Astacin 0.0000795
Further Details:      
 
Domain Number 2 Region: 437-539
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-37
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 3 Region: 741-853
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 321-430
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-35
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 5 Region: 586-696
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-35
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 6 Region: 877-970
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-30
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 7 Region: 695-738
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000155
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 541-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000495
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014730   Gene: ENSONIG00000011697   Transcript: ENSONIT00000014742
Sequence length 981
Comment pep:novel scaffold:Orenil1.0:GL831253.1:501549:530023:1 gene:ENSONIG00000011697 transcript:ENSONIT00000014742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSARCLFLLSCLGVILAIDLDAIDPGYYVEPTATSETIDYKDPCKAAAFLGDIALDEE
DLRSFKVDRIIDLAARTVQVVNRTNTANSSASGRHQGHPGSNSQNRQGARRRKRAATSRP
ERIWPDGVIPYVISGNFSGNQRAIFRQAMRHWEKHTCVTFIEKTTEESYIVFTYRPCGCC
SYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVSIIRDNIQPGQE
YNFLKMEPGEVDSLGEVYDFDSIMHYARNTFSSRGIFLDTILPRYDVNGVRPPIGQRTRL
SKGDIAQARKLYKCSRCGDSLQDSSGNFSSPGFPNGYSAYMHCIWRISVTPGEKIILNFT
SMDLYRSHLCWYDHVEIRDGYWRKAPLKGRFCGDKLPEPIISTDSRLWIEFRSSSNWVGK
GFSAVYEAICGGEVKKDNGQIQSPNYPDDYRPNKVCVWKISVAQGFHVGLTFQSFEIERH
DSCAYDYLEVRDGISENSPLLGRFCGYDKPDDIKTSSNHLWMKFVSDGSVNKAGFAANFF
KEMDECSKPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFITKLNGSITSP
GWPREYPPNKNCIWQLVAPTQYRITLLFDVFETEGNDVCKYDYVEVRSGLSADSKLHGKF
CGAEKPEAITSQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHECVNTFGSY
SCQCRSGFVLHENRHDCKEAGCDHTVNSVSGIITSPNWPDKYPSKKACTWALTTTPGHRI
KIAFNEIDMEAHLECAYDHIDIYDGRDGKAQKLGRFCGTKKPPPITSSGNKLFIRFFSDN
SVQKKGFEASHTAECGGQLKAEVKTKDLFSHAQFGDNNYPGASDCEWVISAEKGYGVELI
FQTFEIEEEADCGYDYMELFDGPDTKSPRLGRYCGSGPPEEIYSAGDSIVIKFHSDDTIN
KKGFHVRYTSTKFQDTLHSRK
Download sequence
Identical sequences I3K0T5
ENSONIP00000014730 ENSONIP00000014730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]