SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014813 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014813
Domain Number 1 Region: 6-58
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000106
Family RING finger domain, C3HC4 0.0073
Further Details:      
 
Domain Number 2 Region: 126-182
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000136
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Domain Number 3 Region: 69-119
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000916
Family B-box zinc-binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000014813
Domain Number - Region: 163-275
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00915
Family HBL-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014813   Gene: ENSONIG00000011767   Transcript: ENSONIT00000014825
Sequence length 360
Comment pep:novel scaffold:Orenil1.0:GL831675.1:125085:138221:-1 gene:ENSONIG00000011767 transcript:ENSONIT00000014825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKLAIVENYLSCHVCSETFRDPVSLSCNHSFCSSCLQKFWEQTKNKNCPICKRKSSKDYP
NKGEKKLTVVCSKHEKESKLFCVDEHRVVCPVCEFSLHQSHKVVPVEEAVSDLKEQTERG
EKKLTVVCSKHEEVPKLFCVDEQSTVCPVCDFSLHQSHKVVPVEEAVSDLKEQLKSDLKS
LQDKRNKYKQVEETYNEMIQHLKKQLLSTERQIRAEFKKLQQFLKEEEESRLAALREEEE
QKGRTISREMKMIEEQISSLSDSICAVEEELQKHSVPFLSSYKDTQSRARAQSSVSDPQL
VSGALIDVAKHLGNLSFRVWEKMKEKVHFSPVILDPNTAIRETHASPKRTKQKSEESENL
Download sequence
Identical sequences I3K118
ENSONIP00000014813 ENSONIP00000014813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]