SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000014911 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000014911
Domain Number 1 Region: 36-319
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.05e-63
Family Regulator of chromosome condensation RCC1 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000014911   Gene: ENSONIG00000011843   Transcript: ENSONIT00000014923
Sequence length 320
Comment pep:novel scaffold:Orenil1.0:GL831253.1:2011675:2253407:-1 gene:ENSONIG00000011843 transcript:ENSONIT00000014923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFVFPRLGNGERAVKNQPVEVKLPQELNVRGSHLDGNFANVVGIACGSRHSFIWTETGQV
YSFGNNFYAQLGYDFQRADFKENQLAPCLFQNLPSSLKISQVACGERHTLFALEDGSVAA
CGQNDYGQIGSGSNENAVVPRFVERVDHVSKVTCGANHNLALTGDGKLFQWGCGRACGST
KGNILSPEEVTLPESPVKDIAGGCWHSLLLTDGGNVFSWGMGQEGQLGLGEDRMHVSTPC
LLNSSQLSEVSQIRAGDSYSAAVTAGGDLLLWGQIPCVSWVTYHAGPKGLWTPQAFPLAG
QKVIDVACGAWHIMALTTSE
Download sequence
Identical sequences I3K1B6
ENSONIP00000014911 ENSONIP00000014911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]