SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015104 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015104
Domain Number 1 Region: 808-916
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-23
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 2 Region: 283-409
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 244-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000686
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 624-784
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000139
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 5-83
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000188
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 98-212
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000188
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015104   Gene: ENSONIG00000011999   Transcript: ENSONIT00000015117
Sequence length 994
Comment pep:novel scaffold:Orenil1.0:GL831213.1:835090:952504:1 gene:ENSONIG00000011999 transcript:ENSONIT00000015117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECAEGSDDCHIDALCQNTAKSYNCICKPGYKGDGTQCEDMDECENDYNGGCVHECIN
IPGNYRCMCYDGFMLAHDGHNCLGEVADDQSSRGSESQVCVNTMGSYECMCTEGFFLSDN
QHTCIHRSDDGMNCMNKDHGCAHICREAPGKGGVSCECRPGFELAKNQKDCTLTCNYGNG
GCQHTCNDTDTGPVCGCHQKYALHSDSKTCIEKDEAAIESSEFNATSVADVDKRVKRRLL
METCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDIDECQENNGGCDHFCRNTV
GSFECSCQKGHKLLTDERTCQDIDECSFERTCDHTCINYPGSFECLCNKGYILYGLTHCG
DIDECSINNGSCEYGCINTQGSYECVCPPGQKLHWNKKDCIEGVKCLPNGKPAPRAQLTC
TKSGGAEVCSLSCPSNALFLADSENSYTLSCGVPVQPGKPPQKRNVTTALPACAGIDTLA
PPIKQKARFKIKDAKCHLKPRNKEKHRDVSKQNIQGGQFPCTDDCQVTFVNLKCDSSKKR
RRGRKSPSKEVSHITAEFEMEMKEEDASESCNVDCVRERMKQRLQSAMRTLRKSITKQQF
YIQFSGTEYEVAQKPPKAAEGAETCSTGQVLRDGKCVSCGVGTFYSGEQEQCVQCPPGTY
QDTVGQLSCEPCPSTEGQGIAGAKNVSQCGGQCPVGHFSDDGFRPCQPCALGFYQPEPGR
VLCFPCGGGLMTKYEGSVSFRDCEAKVHCAPGHYYNSSTHRCIRCPAGTYQSESSQNYCI
TCPGNTTTDFDGATNVSQCKNQVCGGELGEYTGYIESPNYPGDYPSNVDCVWMINPPHKR
RILIVVPEIFLPIEDECGDVLVMRKSAHPTSITTYETCQTYERPIAFTSRSRKLWIQFKS
NEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQ
NYFKYTAAESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences I3K1V9
ENSONIP00000015104 ENSONIP00000015104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]