SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015130 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015130
Domain Number 1 Region: 4007-4363
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.19e-129
Family Hect, E3 ligase catalytic domain 0.0000000338
Further Details:      
 
Domain Number 2 Region: 1621-1686
Classification Level Classification E-value
Superfamily WWE domain 1.57e-17
Family WWE domain 0.0022
Further Details:      
 
Domain Number 3 Region: 1310-1362
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000281
Family UBA domain 0.0065
Further Details:      
 
Domain Number 4 Region: 101-179,277-469,1337-1566,1955-2007,2130-2165,2440-2472
Classification Level Classification E-value
Superfamily ARM repeat 0.00000922
Family Plakophilin 1 helical region 0.056
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000015130
Domain Number - Region: 363-418,489-640,673-690,786-830
Classification Level Classification E-value
Superfamily ARM repeat 0.0691
Family PBS lyase HEAT-like repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015130   Gene: ENSONIG00000012021   Transcript: ENSONIT00000015143
Sequence length 4370
Comment pep:novel scaffold:Orenil1.0:GL831196.1:830667:873629:1 gene:ENSONIG00000012021 transcript:ENSONIT00000015143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVDRSKLKKTPTEAPADCRILIEKLKACNDEQLLVELQHIKTWNIGKCELYHWVDLLDR
FDGILCDAGQTVENMSWLLVCDRPENGQLKALLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASCDMQVVLSVLNLLYVFSKRSNYITRLGSDKRTPLLARLQHLAESWGGKENGFGLA
ECCRDLPMTKYPPSATTLHFEFYAEPGPEVKVERKQTSSNTLHYIHIEQLDKISESPSEI
MESLTMMYNIPKDKQTLLFTHIRLAHGFSNHKKRLQAVQARLHAISILVYSNALQESANS
ILYNGLIEELVDVLQITDKQLVDIKAASLRTLTSIVHLERTPKLSNIIDCTGTASYHGFL
PVLVRNCIQAMIDPLMEPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFL
GDEQDQITFVTRAVRVVDLITNLDMAAFQSHSGLSIFICRLEHEVDLSRKECPFVIKPKI
QRPSAAVESEDMDTDMESMQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHELQVMDGSL
PTSLKHIISNAEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPA
TREVLGSLPNVFSALCLNARGLHSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTA
SNLGSAVDELMRHQPTLKTDATTAIIKLLEEICNLGRAPEYICQKPSIQKADGTVAVPPA
RSSHAAEEASSEDEEEEEALHTFSQQQGEPESSRQVVGTEERIPIPLMDYILNVMKFVES
ILSNNTTDDHCQEFVNQKGLLPLVSILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPK
VLQEGLCQLDSILTSLEPLHRPIEVPGGSVLLRELANAGHVTDATLSARATPLLHALTAA
HAYILMFVHTCRVGQSEIRAISVNQWGSQLGLSVLSKLSQLYCSLVWESTVLLSLCTPNS
LPPGCEFGQADMQKLVPKEEKPSGSTTASSASGSRRTAESEAVSVDSSAGGLLEGMGLDG
DTLAPMETDEPSAADPKTKSKLTPAMATRIKQIKPLLSASSRLGRALAELFGLLVKLCVG
SPVRQRRSHHATSTGTTPTPAARATASALTKLLTKGLSWQPPPYTPTPRFRLTFFICSVG
FTSPMLFDERKYPYHLMLQKFFCSGGHDALFETFNWALSMGGKVPVSEGLEHADLPDGTG
EFLDAWLMLVEKMVNPSTVLDSPHSLPAKMPGVTPTMPQFSALRFLIVTQKAAFSCIRNL
WNRKPLKVYGGRMAESMLAILCHILRGEPVIQERLAKEREGTVRPDDEGTSAGSPRREPQ
VNQAQLTQLMDMGFSREHAMEALLNTSTMEQATEYLLTHPPPLLGGAVRDLTMSEEDQMM
RAIAMSLGQEVSMEQRSDSPEEAARRREEEDRRARERAEEEEARCLERFMEAEPLDPQEL
HAFTDTMLPGCFHLLDELPDTVYRLCDLLMTAIKRSGPEYRDLILGQVVQQVWEAADVLI
KAAEPLTTSDTKTVSEWTRQMATLPQASKLATRILLLTLLFEELKLLGARVIENSGILDL
LIKLLEVVQPCLQAAKEHKDIQTPKWITPVLLIIDFYEKMAVSSKRREQMNKYLQPNGNN
WRWFDDRSGRWCSYSASNNSTIDSAWRAGESSVRFTAGRRRYTVQFNTMVQVNEETGNRR
PVMLTLQKVPRIPKPSKTGSVTDSEREEGDRGKVEESQSDLDSGTAVEMNAPKDDSSQLK
EATSGPSSSLESDYSQGSDIVVQGLTEDMTTVLIRACVSMISVPVDPDTLHATLRLCLRL
TRNHHYAMMFAELKSTRMILGLTQSSGFNGFTPLVTLLFRHIIEDPATLRHTMEKVVRSA
VTSGAGSTTSGVVSGSLGSREINYVLRVLGPAACRNPECFTETASNCIRIALPAPRGAGT
TSDDEFENLRIKGPNAVQLVKTTPLKLSPLPPIPDTIKEVIYDMLNALAAYHAPEEPERP
EERAVAVPGGQDLCQILQDVGDDVYQQYRLTRQGSDFDSQSAFHINTQVFAADGGVAESS
QSGTPQGEASTPEEMREEKKEQEGEKGTTSDESKAAKVKASKPLMPTSTILRLLAELVRS
YVGIATLIASYCYTAGQSELIKEDCSVLAFVLDHLLPHTQNSEDKDTPALARLFLASLAA
AGTGTDAQVSLVNEVKAALSRALAMPEGAEKHARLQAVMCIISTIMESCPSTSSFYSTAA
AKTQHNGMNNIIRLFLKKGLVNDLARVPHSLDLSSPNMANTVNAALKPLETLSRIVNQPS
SLFGGKGGSSKNKTEHDPVGTARDSNSNTQDQGESGEAEPVDGSHRVQGTDTDLMDGETE
GDAVVIAGQPEVLSTQAMQVENELVDLIDELLERDAGTVNSTIIVGRSGEDESQEDVLMD
EAPSNISQASTLQANREDSMNILEPEDEEHTQEEDSSGSNDDEDSQDEEEEEEEEEEEDQ
DDEEGDEDDDDEGSEMELDEDFPDINAAPHIRFERFDRDDDLIIEFDNMFSNNADIPPSP
GNIPSSHPLMVRHADHGSLTLGVAGTSSRLAQGMGRSQRTLRQLTANSGHTIHVHYPHNR
QPNPPLILQRLLGPSAAADILQLSSSLPLQSRGRARLLVGNEDVHIIARSDDELLDDFFH
EQSSTGGQAGTLSSIPTALTRWTDECKVLDAESMHDCVAVVKVPILQHLESLRDEELEER
REKRRRQLAEEEESKQNERRASGAEQAREQSLQLNSLTYVDWTTQRVSEGFLTAPPSGEV
TPTTPAPHEQALVSLETAISQQVHQPIADLLLAESHASSLAALAGAGLPLLSTGERPNSE
AEASQMEMSPAPAIASLSPDIVENSEPAAAGVSQLEGSPMDTSSPASATQEEAAPNPAQP
TQLSQELSGSGESGLTDSYEPAPLDGLSEHHGYRRQEPRSTSVSSPGETMPRSDSADSQS
QAIQEEPLPSTSNEEEDPLAGISLPEGVDPSFLAALPEDIRREVLQNQLGIRPPSRPPAA
TSLPSSTAPVLGGPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQQPPQGDTPLD
PVTFIQTLPSELRRSVLEDMEDSVLAVMPPDIAAEAAALRREQEARQRQLMHERLFGHSS
SSALSAILRSPAFTSRLGSNRGVQYTRLAVQRGGTFQMGGGTNHRPSSSSVDSLLRLRGR
LLLDHEALSCLLVLLFVDEPKLNTSRLHRVLRNLCYHSQTRGWVIRSLLSILQRSSESEV
CVETSRLEDSRGKRTSQGSCGASSSSPASSLELLNRVESRSSSQLSWLSVSMDAALGCRT
NIFQIQRASGRKHADRHSGGGSTVHIHPQAAPVVCRHVLDTLIQLAKVFPSHFTQQRWSQ
SQSNPNASNTQNSLGSTASTLQSLGISTDFWDLLVKLDNMNVSRKGKASMKTVPLGGSAE
AEGAQFSLETSPLGQLMNMLSHPVIRRSSLLTEKLLRLLSLISIALPDNKATEVPAGHPT
PQAPNPNTATSSGATASVTTQGTAAVGAMQSTVAGPGASVGAVAQGTSSGTSIATSQTSS
TTISIPTSTGTISTGKQRGVASNTESEKLASTGLTEKQLQLSVEVLTSHSCSEEGLEDAA
NILLQLSRGDASTRDTVLRLLLSGARHLGYTLCKQIGTLLAELREYNLEQQRRAQADSHS
PDAPPEDSSISARLKGKMTSRFDGSESVVIVAAQKRTLGGRELQLPCMSSLTSKTSTQKF
FLRVLQVIIQLREDTRRANKKAKQTGRLGSTSLGSASSIQAAVRQLEAEADAIIQMVREG
QRARRLQQASEGQSVSESQAAQRDDSPMDVDQPSPLEQDPAPLDEEGNGQSESEERLPDL
PLLSEQLLLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTR
ESQLSHIKDEPPPLSPAPLTPATPSSLDPFFSREPSSMHISSNLPPDTQKFLRFAETHRT
VLNQILRQSTTHLADGPFAVLVDYIRILDFDVKRKYFRQELERLDEGLRKEDMAVHVRRD
HVFEDSYRELHRKSPEDMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTS
PGDRVTYTINPSSHCNPNHLSYFKFVGRVVAKAVYDNRLLECYFTRSFYKHILGKSVRYT
DMESEDYPFFQGLVYLLENDVSTLGYELTFSTEVQEFGVCEVRDLKPNGANILVTEENKK
EYVHLVCQMKMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPAIDIDDLKA
NTEYHKYQSSSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQ
IHRDDRSTDRLPSAHTCFNQLDLPAYESYEKLRHMLLLAIQECSEGFGLA
Download sequence
Identical sequences I3K1Y5
ENSONIP00000015130 ENSONIP00000015130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]