SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015133 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015133
Domain Number 1 Region: 766-842,873-961
Classification Level Classification E-value
Superfamily RUN domain-like 6.28e-37
Family RUN domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1123-1300
Classification Level Classification E-value
Superfamily RUN domain-like 1.31e-27
Family RUN domain 0.021
Further Details:      
 
Domain Number 3 Region: 969-1067
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 3.08e-18
Family Lipoxigenase N-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015133   Gene: ENSONIG00000012023   Transcript: ENSONIT00000015146
Sequence length 1307
Comment pep:novel scaffold:Orenil1.0:GL831213.1:1268121:1351331:1 gene:ENSONIG00000012023 transcript:ENSONIT00000015146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTSAGSAAAPCRFAHYFVICGIDTETGLEPDELAALHRWLEADRQGRDPDTAPAGENF
EQSPLKRTFKSKVLARYPENVEWNPFDQDAVNMLCMPKGLSFRTQADQREPQFHSFIITK
EDGSRTYGFVHTFYEEVTSPQICSAMQTLYQMHNAEQTNATSSSSSSSSSMDSLASSLDD
GYSPTSSSSSSLSRAAGSYDSSRDTLYVSKALCLITPMPFMHACRRFLAQMHSAVIAATT
PPLPLESYVYNILYEVPLPAPGRSLKFHGIYEPIVCQRPGPGELPLADFPLAEAFALLGV
ENLVQVFTCTLLEMQILLYSQDYQRLMTVAEGITTLLFPFQWQHVYVPILPASLLHFLDA
PVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHSIELPEDFPQFPNKTEFIQELTEVL
LSFGISANTGAPPRTRSSPGSTSSTPGRERKSATLRQLEDDGRNGNLAGEELVVLELLQG
NATLERLQALTKRTGVTVARVDALRAGVKSQPTEGQGNQIGGEEEELRNAKLNVQLREVF
ASRFTTMFADYESFVIQSAPDLESWLTNREQMHNFDKASFLSDQPEPYLPFLSHFIETQM
FATFIDNKIMSQWEEKEPMLHVFDTRIDKARLYNIRAPSLRSSCYQRCSILKESAQAIEK
RLMKIDHTAIHPHLLDMKIGQGKYEQGFFPKLQTEVLNTGPSINKWCHKATTAQRRKDRH
RQQTEHLTLDNDLKEKYMQEARSLGKNLRQPKLSDLSPAVIAQTNWKFVEGLLKECRMKT
KRMLVEKMGREAVELGHGEASITGLEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLL
HYQAREEMLAQQADSPAPHILERRKSDSSIAMPSLRVSLIQDMRHIQSMSEIKTDVGRAR
AWIRLSLEKKLLSQHLKQLLSRQALTKKLYKRYAFLRCEEEKEQFLFHLLSLNAVDYFCF
TSVFTTIMIPYRVVIIPIKKLSNAMTTSNPWVCVSGELGDSGIMQIPKNVLEMTFDCQNL
GKLTTVQLGHDNAGLLAKWLVDCVMVRNEITGHTYRFPCGRWLGKGVDDGSLERVLIGEL
VLPSGEDDSARACRTPPLQRSPSQGRRISITSLTGRDTKLNSAQIQEGIGEAVNNIIKHF
HKPEKERGSLTVLLCGENSLVAALEQFFHHGFKSARLFQKTVFVWDFVEKAVAYMESADQ
MGDLQETTEAMKMTCQSLCHYFNAINSTSRNIGKDGKFQLLVCLGARDRLLPQWLPLLVE
CPVILQMYEDTAMLRDPSTLNTLISVLETLHDFSITLEASLVKGINL
Download sequence
Identical sequences I3K1Y8
ENSONIP00000015133 ENSONIP00000015133 XP_019202596.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]