SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015196 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000015196
Domain Number - Region: 81-164
Classification Level Classification E-value
Superfamily Cupredoxins 0.00851
Family Plastocyanin/azurin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015196   Gene: ENSONIG00000012073   Transcript: ENSONIT00000015209
Sequence length 248
Comment pep:novel scaffold:Orenil1.0:GL831213.1:1932242:1935302:1 gene:ENSONIG00000012073 transcript:ENSONIT00000015209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPFLLSSYLRDGGRTSYENRSQNTPKSADSPSTRIMLQFPAVQIDAGQGNIVMTDSNNY
AYFLIGSQWYKMGSLTLKHVSVGPAGIWGVDLNNRVYKYVAGSFVFANGETLQQVDAGGD
SQVVGVTDTSTIHCLKSTIVSAYRKQSTLSWITLPGLLMYVSCSTKYGCWGVNSAENIYF
TKITPSTCGISGWIQVDGLAVMVEIGTDGSVFVVTRGGEVFQRQGIDSSTPQGTSWTQIP
MPSRISHM
Download sequence
Identical sequences I3K251
ENSONIP00000015196 ENSONIP00000015196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]