SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015351 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015351
Domain Number 1 Region: 276-431
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.09e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000539
Further Details:      
 
Domain Number 2 Region: 432-598
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.21e-38
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000252
Further Details:      
 
Domain Number 3 Region: 150-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-34
Family Spermadhesin, CUB domain 0.0000243
Further Details:      
 
Domain Number 4 Region: 38-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-32
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 5 Region: 632-788
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-29
Family MAM domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015351   Gene: ENSONIG00000012186   Transcript: ENSONIT00000015364
Sequence length 924
Comment pep:novel scaffold:Orenil1.0:GL831144.1:6928315:6978659:1 gene:ENSONIG00000012186 transcript:ENSONIT00000015364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNQYAQGCRALCVHVCRILIYVSFTAPECGGLLDASEAGYITSPGYPLEYPPHQNCHWII
TAPEPSQRIVLNFNPHFEIERLDCKYDFIEIRDGTSETADVLGRHCSNIAPGPIISSGPS
LQIRFVSDYAHQGAGFSLRYEIFKTGSEFCFRNFTSPSGMIESPGFPDKYPHNLECSYMI
IAPPHMDITLTFLTFDLENDPLLVGEGDCKYDWLDVWDGLPQVAPLIGRYCGTKIPPEIQ
SSSGLLSLSFHTDMAVAKDGFSARYNMTQKEVSDSFHCSMALGMESGKISDDQITASTSF
YDNRWLPRQARLNNDDNAWTPAEDSNKEYIQVDLHFLKVLTGIATQGAISKETQKSYYVT
TFKLEVSTNGEDWMVYRHGKNHKIFHANTDPAEVVLNRVPQPVLARFVRIRPQTWKNGIA
LRFELYGCQITDAPCSDLQGLMSGLLPDAQISTSSSRDVVWNPGSTRLVASRSGWFPAPA
QPLAGEEWLQVDLGLAKTVRGVITQGARGGDAGSGAATDNRAFVRKYKVAHSLNGKDWNF
IMDSKTSLPKIFEGNTHYDTPELRHFEETVAQYVRLYPERWSPAGIGMRVEILGCDLPET
STPADTTTPTLPADVETTTVPVTTTAATSPPSDTVCEFDHGLCGWTHDPNAPLLWSLHSN
ETTNSSPLDLAPDTKLNSYLYIDASLKTEQQRARLLSPVLTADTGPLCLVFSYQISGEAQ
GHLRVLVQDAHFEETVLWTLTDDQGPVWKEGRTILPRSPKSVQVVMEGYFVHGTRGHIWI
DNIHISSSTPLTECTQPFAAFPPENPVKRPGGDGRIYGGPLGGGLQFPERNTPSPSSEPP
VTRVSEKDNSWLYTLDPILVTIIVMSSLGVLLGAVCAGLLLYCTCSYSGLSSRSSTTLEN
YNFELYDGLKHKVKLNQQRCCTEA
Download sequence
Identical sequences I3K2K6
ENSONIP00000015351 ENSONIP00000015351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]