SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015443 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015443
Domain Number 1 Region: 27-137
Classification Level Classification E-value
Superfamily TPR-like 3.56e-30
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 
Domain Number 2 Region: 178-255
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000296
Family Canonical RBD 0.012
Further Details:      
 
Domain Number 3 Region: 137-180
Classification Level Classification E-value
Superfamily UBA-like 0.0000365
Family UBA domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015443   Gene: ENSONIG00000012263   Transcript: ENSONIT00000015456
Sequence length 310
Comment pep:novel scaffold:Orenil1.0:GL831192.1:1771821:1777118:1 gene:ENSONIG00000012263 transcript:ENSONIT00000015456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMNENEEEEQKKSMDPILEEYAKRSIEFANMGNRLAASGQYEKAVKCFTEAIKFNPKEFK
LFGNRSLCFERLQQYESALTDADVALSMEPNWIKGLFRKGKALCGLKRYYEASLIYKEVL
RLESTSAEAAQELKRAQTLHLMEMGFSWALSSEALKTHGTLEEAVEALFARRVDCPTTKP
PSNAAVWTGLLAPTVTYVKLHELFSRAGAVYSIKMLLEQQCAFVNYTRKEDCDKAIQCIN
GMIFEGAPLTVRYPYKVHPELGGSKLAATDRCPRPSTYKKECFFWRTTGCTRDDCTFRHV
PEHKNIDRDK
Download sequence
Identical sequences I3K2U8
ENSONIP00000015443 ENSONIP00000015443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]