SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015488 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015488
Domain Number 1 Region: 30-313
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.19e-79
Family Regulator of chromosome condensation RCC1 0.017
Further Details:      
 
Domain Number 2 Region: 355-464
Classification Level Classification E-value
Superfamily POZ domain 5.89e-26
Family BTB/POZ domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015488   Gene: ENSONIG00000012298   Transcript: ENSONIT00000015501
Sequence length 530
Comment pep:novel scaffold:Orenil1.0:GL831144.1:7372112:7380935:-1 gene:ENSONIG00000012298 transcript:ENSONIT00000015501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSKWSLFYLLSAQELATVRQACVFGTTANEAIYITHGNEVFVFGLNCSSCLGTGDGLS
TVMPKKLDFLRGKKVASLSYGSGPHVLLATDDGQLFAWGHNGYSQLGNGSTNPGLSPVLI
TANLQNKKVKEVSCGSHHSMALTLDGEVFAWGYNNCGQIGSGSTANQPYPRKVTGCLQGK
NASGITCGQTSSMALVDNGEVYGWGYNGNGQLGIGNNGNQLTPCRVAALQGMCIQQIVSG
YGHCLALTDKGLLYAWGANTYGQLGTGTKSNHLSPVHIMADKERVVEVAACHSTHTSAAK
TQSGQVFMWGQCRGQSIVLPHLTHLTNTDDVFACFATPSVMWRLMSMEQDDFLTVAEALR
KEFDSPETADLKFSVDGKYIHVHKAVLKIRCEHFRSMFRSQWTEDQQEVIEIGQFSYPVY
RSFLQFLYTDTVDLSPEDAIGLLDLATSYCENRLKRLCQQIIKRGITVENAFTLLSAAIR
YDAEDLEEFCFRFCINHLTRVTQTEAFWQVDGAMLKEFISKASRCGAFKN
Download sequence
Identical sequences I3K2Z3
ENSONIP00000015488 XP_005450136.1.78416 ENSONIP00000015488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]