SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015493 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015493
Domain Number 1 Region: 251-563
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-43
Family Kelch motif 0.0041
Further Details:      
 
Domain Number 2 Region: 686-828
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-23
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 3 Region: 35-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-23
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 967-1013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000318
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000015493
Domain Number - Region: 885-919
Classification Level Classification E-value
Superfamily Plexin repeat 0.00204
Family Plexin repeat 0.003
Further Details:      
 
Domain Number - Region: 604-637
Classification Level Classification E-value
Superfamily Plexin repeat 0.0518
Family Plexin repeat 0.0055
Further Details:      
 
Domain Number - Region: 4-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family EGF-type module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015493   Gene: ENSONIG00000012302   Transcript: ENSONIT00000015506
Sequence length 1333
Comment pep:novel scaffold:Orenil1.0:GL831192.1:2393079:2516758:-1 gene:ENSONIG00000012302 transcript:ENSONIT00000015506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAKECDKPCMNGQCNTATGECVCFPGWVGDQCQHCGGRFRLTGPSGYLTDGPGNYKYKTK
CTWLIEGQPNTILRLRFNHFATECSWDHLYVYDGDSIYAPLLAAFSGLIVPERYGNETVP
EVVSQSGYALLHFFSDAAYNLTGFNISYRVNTCPNNCSGHGECQVGNSTSSVYCKCETYW
KGEACDIPYCLADCGEPERGSCKDKTCVCKTGWQGPDCSVSVPANSSFWSREEYTEAGLA
RASHKAVVEQGVMWVIGGYVFNASDYHMVKAYNISSKTWMSLDPSVNTVTPRYGHSLALH
EGKIYMYGGKIDATGNVSSQLWVFHIQNQTWVLLSPRAKEQYAVVGHSAHIVPPVHEGDG
PVMLVLFGHCPLYGYISQVQEYNIAKNTWSIVSTDGALVQGGYGHSSVFDPSTRAIYIHG
GYKAFSANKYGLAGDLYKFDVGKRKWTILRDSGFFRYLHTAVMVSGMMLVFGGNTHNDTS
MSHGAKCFSSDFPALCAACDEWTVLPRPDLYHDVNRFGHSAVFSDGVMYVFGGFNSLLLS
DVLTYTSPSCSAFSSPTSCSQAWPGIHCVWNATQEACLPWESDVIGTEQQQQPSCNTRSY
GDAERCDQYTDCYSCTANTNGCQWCSSQCVSLGSNCTSASGAIAEYEVCPKDNPSYVCNK
KTSCKSCAVDQNCQWDSRNQECISLPENVCGESWHLVGNSCLKFITTKDSYDNAKLTCRN
HNAVLASLTTQKKVDFVLKELQIMSVVYKATVTPWVGLRKINVSYWCWEDMSPFTNTTLQ
WLPGEPSDAGFCGYLAEPAATGLKAQTCISPVNGSLCERPANHSAKQCRTPCAMRTTCSE
CTSSSSSECMWCSNMKQCVDSNAYVASFPFGQCMEWYTMNTCPPENCSGYRTCGQCLDQP
GCGWCTDPSNTGKGQCIEGSYRGPFQTSVPAPSTLPGLPANPQPALNASMCPSESKYNWS
FIHCPACQCNGHSQCVNESICEKCEDLTTGRHCESCISGFYGDPTNGGSCQPCKCNGHAS
MCNPNNGKCFCTTKGIKGDRCHLCEVENRYQGNPLKGTCYYTLLIDYQFTFSLSQEDDRY
YTAINFVATPEEPNRDLDMFINASKNFNLNVTWATSFTAGTQAGEEIPIVSRSNIKEFKE
SFSNENFDFRNSPNITFFVYVSNFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLV
AAVVWKIKQSCWASRRREQLLREMQQMASRPFATINVALETEEEPPDLIGGNVKSVPKPI
ALEPCFGNKAAVLSIFVRLPRGTGGIPPPGQSGLAVASALVDVSQQMCVGYKEKSGGLRN
RKQQPTAQPSTCI
Download sequence
Identical sequences I3K2Z8
ENSONIP00000015493 ENSONIP00000015493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]