SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015672 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015672
Domain Number 1 Region: 41-155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000275
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 2 Region: 442-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015672   Gene: ENSONIG00000012442   Transcript: ENSONIT00000015686
Sequence length 622
Comment pep:novel scaffold:Orenil1.0:GL831681.1:833:9967:-1 gene:ENSONIG00000012442 transcript:ENSONIT00000015686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFYSLCVRVCLISWNQSAGRSVERHSFTDDSGAENTFFALRSCHRLLYSDSGEFFSPDYL
CSNPPLWCNWTIQVDPSKRIHLYLEDLTPDDICNLKQDQIHIDEPVGDLAGHKVLQKCWQ
EAKYTTSSNILYVVLLIGGWPNPLYRGFYGRYQAFGSPVIFNPGEGFTETSNESETSPGL
MDLSESGPGTKREQMGKKFSNFFQSTFQFLCSVNHVDKNNPPSLSGNYTTMPTESVSTQR
TFRSGRGITHTRLEVTTDTTTAKQMNEEESTVAEDETTTLSWTVKENITEVNQTSVQLPS
PSDSLTWWSHCQTTDGTSLIANMKNDSNIQHFPGDHLFEVAIEINFSQDLVESWDNLARS
LLLSVKALISKQLEALHEQLSVSSKRIKRLHAGVLYILWLQVRQGPRGMHVHRAIHSALQ
GLIATGINFKGNLRKAIIMSVSTADVNECGTQLVQCDINADCVNQFGSYSCHCRAGFQDE
SRLGSGGTICVDMKAAGCSSNLSTETKGVYVLFFLLSSLILALLVVAGMLYHRHHWGKFL
VRCHSNSSLSPSDPNNNHQPEENYSNPADSDPPPPSPPAWGPRECWGHVKEQRPVVDLQL
LRFNLLHPPDSYMDQQEGVNSQ
Download sequence
Identical sequences I3K3H7
ENSONIP00000015672 ENSONIP00000015672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]