SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015741 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015741
Domain Number 1 Region: 19-124
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0022
Further Details:      
 
Domain Number 2 Region: 215-317
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-20
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0091
Further Details:      
 
Domain Number 3 Region: 124-206
Classification Level Classification E-value
Superfamily SRCR-like 5.23e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.012
Further Details:      
 
Domain Number 4 Region: 314-368
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015741   Gene: ENSONIG00000012503   Transcript: ENSONIT00000015756
Sequence length 369
Comment pep:novel scaffold:Orenil1.0:GL831271.1:184657:189469:-1 gene:ENSONIG00000012503 transcript:ENSONIT00000015756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLAPYTAGMQLGLSTEFARLVRGASRCAGTLEIKHLGEWRPVDMSDWTLKTSAVFCEHL
DCGSAVSVESGAALGDLCSGRLEVKSKEFQCGGHESALLDCRSSGSARNSCSLGKAVGLT
CSEPVRLVGGANHCEGTVEVKQGGWRSVGSSDWSLKEAAAVCQHLDCGSAVSAGQRKAVS
LRSMWRITPDCVHSGSALRECARLNLFFYIQHLTCQDSVRLLNGSSLCSGRLEVKSNQSW
SSVCEADFDQHHWNLKAAAVVCEHLDCGSAVSAQSEDSTQKSVWLIRPDCVKPGSALWEC
AKSGYSSNVLKVTCSEPNNVRLVGGASHCAGTVEVKNLGEWRPVEESDWTLKAAAVVCEH
LDCGSAVSV
Download sequence
Identical sequences I3K3P6
ENSONIP00000015741 ENSONIP00000015741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]