SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000015742 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000015742
Domain Number 1 Region: 299-401
Classification Level Classification E-value
Superfamily SRCR-like 6.28e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00081
Further Details:      
 
Domain Number 2 Region: 401-507
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0016
Further Details:      
 
Domain Number 3 Region: 196-298
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 
Domain Number 4 Region: 99-195
Classification Level Classification E-value
Superfamily SRCR-like 5.89e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0057
Further Details:      
 
Domain Number 5 Region: 1-86
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000222
Family Scavenger receptor cysteine-rich (SRCR) domain 0.023
Further Details:      
 
Domain Number 6 Region: 509-561
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000183
Family Scavenger receptor cysteine-rich (SRCR) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000015742   Gene: ENSONIG00000012504   Transcript: ENSONIT00000015757
Sequence length 562
Comment pep:novel scaffold:Orenil1.0:GL831271.1:298376:325413:1 gene:ENSONIG00000012504 transcript:ENSONIT00000015757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRLVGGAGHCAGTLEAKHLGEWRPLCASHDSWTLKEAAVFCEYLDCGSAVYVEERHSSYT
SAWLISSDCVLSRSPLRECTTSDYTDQILKLTCAEVFKYSVRLLNGSSLCSGRLEVKSNQ
SWSSVCDSDWSLKEAAVVCIHLDCGPAVSVKKRHNFSWRSRWKINSDCVQPGAPLRDCTT
SADTDQILNITCSDSPDSVRLLNGSSLCSGRLEVKSNQSWSSVCEDKWKKLKIEVSCTHF
TGSTRKMNNNTHPQREAPVWSKEFQCGGHESALLDCRSSGSAGNSCSPGKAVGLTCSEPV
RLVGGASHCEGTLELKYLGEWRPVYDSLWSFKKAAVLCYYLDCGSAVSVTQKSVYGEVEA
PVWSKEFQCGGHESALLDCRSSGSAGNSCSPGKAVGLTCSESDDVRLVGGPSRCAGTLEL
KHLREWRPMGYFHVSWTMKEAAVMCEHLDCGSAVSIEAGALYGEVEAPVWSKEFQCGGHE
SALLDCRSSGSARNSCSPGKAVGLTCSVNDVRLVGGPSRCAGTLELKHLAGWRPLCGSHD
SWTLKEAAVFCEHLDCGPAVSI
Download sequence
Identical sequences I3K3P7
ENSONIP00000015742 ENSONIP00000015742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]