SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016118 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016118
Domain Number 1 Region: 30-163
Classification Level Classification E-value
Superfamily Cupredoxins 5.6e-50
Family Ephrin ectodomain 0.000000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016118   Gene: ENSONIG00000012804   Transcript: ENSONIT00000016133
Sequence length 229
Comment pep:novel scaffold:Orenil1.0:GL831141.1:3685733:3766181:-1 gene:ENSONIG00000012804 transcript:ENSONIT00000016133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQVDMILFLILIIGMCVYGQDPASKVVSDRYAVFWNRTNPKFYRGDYHIDVCINDYLDI
YCPHYVGPVADDRAERYVLYMVNYDGYSSCDHNSKGFKRWECNRPLSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYYYISSISDDRGRRSCLRLKVFVRPQNNCVKNSGTVEEGVNFDDN
SHNSLEPGDGVSHESPEPARRDVNSAGLCQTSVLLLSSTLILLAVILSL
Download sequence
Identical sequences I3K4S3
ENSONIP00000016118 ENSONIP00000016118 XP_003440124.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]