SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016272 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016272
Domain Number 1 Region: 460-728
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-72
Family Eukaryotic proteases 0.0000385
Further Details:      
 
Domain Number 2 Region: 52-166
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-30
Family Spermadhesin, CUB domain 0.0000622
Further Details:      
 
Domain Number 3 Region: 215-330
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-24
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 4 Region: 334-404
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0005
Further Details:      
 
Domain Number 5 Region: 401-473
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000612
Family Complement control module/SCR domain 0.00061
Further Details:      
 
Domain Number 6 Region: 162-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000758
Family EGF-type module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016272   Gene: ENSONIG00000012936   Transcript: ENSONIT00000016287
Sequence length 729
Comment pep:novel scaffold:Orenil1.0:GL831225.1:1113172:1123465:-1 gene:ENSONIG00000012936 transcript:ENSONIT00000016287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYLNVRHLLSQQPTSSLMGTFNRKMRWASCIIWFLYVSLCECSPLPEPEPQMYGEVQSP
LYPQPYPPNLQEQWDLAVPEGYQIRLTFTHLDIEASANCYYDSLTVFYKEKALWKFCGSE
NSADGHHPGNQPILSPGNSLTLIFQSDSNNPEAHQNLGFSAQYQAIDIDECSAPEPGDGS
GPLCSQICLNTLGSYLCSCHHGYELRSDQRTCVLSCGGGIFDEPEGHLFSPGYPNHPPHA
VSCQYVISVQEGFTITLNFTDNFHIESMDSPEGPQCLHHWLELTVRDEQPIKLCGRTSPG
VIVTNSNMVKLEYHTDDEGQSNGWSLDYSTHRVKCPLPGSVAKGRVTPSLSEYLFRDYIY
VRCDQGYKLMMNGREIESFSTICQSNGKWHRPLPECRIIDCGEPDPLLNGGVAFLSGFQN
QYLSVIQYRCNEPFYSLLGDANVNFTCDADRKWRSTHEVIDSPLCLPVCGQPTNHINVYQ
RIFGGQDAPDNTIPWQVLLSVSGKRAGGMVIGDRWVMTAAHNIVDKGAVVSNDTLQIFMG
LNEVTALKKSPLFAASIHVHPEYNNPSYVDYNNDIALIKLEDTLTFNSSVMPVCLPEPGA
TYDTGVMGLVSGFGLTIENNRQILTNQLKYVYLPVVDQQTCRDSITSARRRSNNIPDLTT
NMFCAGLPEGGKDSCQGDSGSPFTLTKDGRHWAAGIVSWGVDCGRKGTYGVYTRVANYLN
WIQKTMQEN
Download sequence
Identical sequences I3K577
ENSONIP00000016272 ENSONIP00000016272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]