SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016364 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016364
Domain Number 1 Region: 320-490,526-661,721-827
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-82
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0009
Further Details:      
 
Domain Number 2 Region: 174-282
Classification Level Classification E-value
Superfamily RING/U-box 2.24e-36
Family Zf-UBP 0.00000349
Further Details:      
 
Domain Number 3 Region: 685-739
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000488
Family UBA domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016364   Gene: ENSONIG00000013010   Transcript: ENSONIT00000016379
Sequence length 829
Comment pep:novel scaffold:Orenil1.0:GL831225.1:1392502:1405503:1 gene:ENSONIG00000013010 transcript:ENSONIT00000016379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVGELLMSVLSTIRVPKPGDRVHKDECALSFSSPESEGGLYVCMNSFLGLGSQYVDRH
HARSGQRAYLHITRTRKAKKEDDGNSGSGHPPKKKPTRLAIGIEGGFDVEQEQYEEDVKV
VILPDRQEVTSEDLTTMPDVVRERVSLSMAGIMAADSVSHTLQVQQWDGEVRQESKHAAD
LKQLDNGVKIPPSGWRCEVCDLQENIWMNLTDGKVLCGRRYFDGSGGNNHALLHYQETGY
PLAVKLGTITPDGADVYSYDEDDMVLDSKLPEHLAHFGIDMMTMEKTERTMTELEIAVNQ
RVGEWEVIQESGTTLRPLFGPGLTGMKNLGNSCYLNSVMQVLFTIPDFQSKYVSNIDKII
DEAPSDPTQDFKTQVAKLGYGLLSGDYSKPAPDPGEENGAAEPRGDQIGIAPQMFKALVG
RGHPEFSTNRQQDAQEFLLHFINMVERNCRSGSNPSEAFRFLVEERIVCQQSQKAKYTQR
VDYIVQLPVPMDQATNTEELQEAERRREEGDSSAPTVRAQIPFTACMAALSEPEILTDFW
SSAVQGKTTATKTTRFASFPDHLVIQIKKFTFGLDWVPKKLDVSIDVPDTLDLSGLRATG
QQPGEELLPEVAPPPLMTPDVEVKAPVLDDSTVSQLCEMGFPLEACRKAVYYTGNTGIDA
AMNWIMSHMDDPDFSAPLVLPGCSSGPGTTPTESLSEEHLATIVSMGFSRDQATKALRAT
SNVLDRAVDWIFSHLDDLESMDVSEGGRSAAESEGGRDPPPGPRVRDGPGKYELFAFISH
MGTSTMCGHYVAHIKKDQQWVIFNDQKVCASEKPPKDLGYLYFYRRVAE
Download sequence
Identical sequences I3K5G9
XP_005455534.1.78416 ENSONIP00000016364 ENSONIP00000016364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]