SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016539 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000016539
Domain Number - Region: 201-338
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0994
Family HBL-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016539   Gene: ENSONIG00000013149   Transcript: ENSONIT00000016554
Sequence length 913
Comment pep:novel scaffold:Orenil1.0:GL831141.1:8465093:8484722:-1 gene:ENSONIG00000013149 transcript:ENSONIT00000016554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAQSLQSGPGIFSGKQSEERDWVALGSTRNVHSRSGLAAGMSHTKLLFNDTIPASTRNR
ATHVGLPAPIVIERLLPVSEVKENVDSTRSSFSFTTLSEERLQAAVKQAKRDLRRRRLES
LTKLSAKPSQEASLFETSDVELRQEFAASPSKMMSKASSPKEKVTVAGAKRHTSQKHPIS
SMPRIGRSPPTRDPGLRQVEGDKEAPLSHEIHRLQNELEVYIQKVEELANRGEKIQESLE
PEEENKLEIRRQKQAARSARIIYVLQQQVKEIQEDIEKLRSQKMWDAKKSMAINRLAAAH
RGALRALQVFIHQLSDLSHSKVPPYSKELGQLIRQLSLCSAKVEVDQGSAVPETALDILQ
KLETLDSALSKQEMLIKMQAQACLPQRKSPHRSKSPTAAPRHPKLQGIARGPCKAKNPRR
GLHDKRVASQKPKTTQQPLNRREVLRSGLESLVQQRELQRRSQTNTNSRKELPSQRKTAE
TIKHNQMEDAGFQQPTVSSRLRVNQLPQKEHSVPWIPTSPHSPPPQRSPHRGRPEPRCLF
SPVKSSPNPPKQRPGGSLATEPGLSSQRKKEAQNEALRKAWLDKITAQRLQELNQLSKEE
AERIQRLRSEVVSPTQWAERAEQKARERIQPLLDEAQQIGESRNNRINSPLRSRVPEQAA
ERAEESAEQLSEELLEDLLEDTAWVAWTVKTDRQLQDMAQDRLQAPTLESMLLRMEEIQR
DQEEVRRRFASITYSDPLYLKQPGPAGSQSHAPSSRPASPQPIRLTNPVLKQTSAADIVL
EKPVETGFLCENSLTEEASQDEHHPANNTMFPGPLEGSKATVISVPGSMLRSIRQYREDY
EDYLRAVAHEAVGSFDPWAVADGLADELLSEALADVAAEFQDVVEEYAEAVFTSEFLQPT
RSPPASAAALAGQ
Download sequence
Identical sequences I3K5Z4
ENSONIP00000016539 ENSONIP00000016539 XP_005474804.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]