SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016563 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016563
Domain Number 1 Region: 1-259
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-85
Family Protein kinases, catalytic subunit 0.00000296
Further Details:      
 
Domain Number 2 Region: 318-688
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.44e-75
Family Regulator of chromosome condensation RCC1 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016563   Gene: ENSONIG00000013168   Transcript: ENSONIT00000016578
Sequence length 698
Comment pep:novel scaffold:Orenil1.0:GL831141.1:8854869:8869212:-1 gene:ENSONIG00000013168 transcript:ENSONIT00000016578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKYEKIKVVGRGAFGIVHLCRRRSDMAYVILKEIPVEQMSRDERLAAQNECQVLKLLNH
PNIIEYYENFLEDKALMIAMEYAPGGTLADYIQKRCNSLLDEDTILHFFVQILLALYHVH
NKLILHRDLKTQNILLDKHQMIVKIGDFGISKILVSKSKAYTVVGTPCYISPELCEGKPY
NQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILNMLN
LDPSKRPQLNEIMALPICIRPLLNLYTDIGNVKMRRIEKPLSTVQTGPQGRPGGRVPANR
SRGEACSYLTRPGKVHSLPLSSVYTWGSGISTPLRLPMLNTEVLQVSLGRTQKMGVTKSG
RLITWEAPSVGSSEASLPGVVEQIQPQFISRFLEGQSGVTIKSVSCGDLFTTCMTDRGII
MTFGSGSNGCLGHGNFNDVTQPKIVEALLGYELIQVSCGASHVLAVTNEREVFAWGRGDN
GRLGLGTQDTHNSPQQVCLPGDFEAQRVVCGVDCSMIISNQHSIVACGSNRFNKLGLDKI
TAGEEPNPLNQVEEVHSYTPVQSAPLNTEKIVYIDIGTAHSVAVTENGQCFTFGSNQHGQ
IGSSSRRSSRAPCKVSGLQGITMAACGDAFTLAIGSEGEVYTWGKGARGRLGRKEEDSGI
PKPVQLDESHPFAVTSVACCHGNTLLAVKLFFKELRDK
Download sequence
Identical sequences I3K618
ENSONIP00000016563 ENSONIP00000016563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]