SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016637 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016637
Domain Number 1 Region: 23-109
Classification Level Classification E-value
Superfamily UBA-like 8.41e-30
Family UBA domain 0.0000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016637   Gene: ENSONIG00000013231   Transcript: ENSONIT00000016652
Sequence length 1176
Comment pep:novel scaffold:Orenil1.0:GL831238.1:210678:227259:-1 gene:ENSONIG00000013231 transcript:ENSONIT00000016652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSLVSNQARGTRDKTLPTTTQTTQQQKQIQATAEQIRLAQVIYDKNDADFEDKVKQLI
EVTGKTQDECMVALHDCNEDVNRAINFLLESTSDTTSWETVGKKRSLGKEGGPSEIKESR
EKKGEREASRGRGGSTRRGRGISRGREGRSEENGFDVAPGERGGDRGRRGRGRVAGVRGR
GRAAVGNRFSSQGMGTFNPADYSANAGARQEAWEGDGNEAAEEAGTWGGNPEDWSSEDWN
EDLSETKVFTASSAPKNHITPGNNVDLAGILPKAGVGVGSSVDSDLGAIVDGPAPEDLGQ
SLVFTNSHHNGRTATHSYAHATANSYAHAASGSTTYAHAALSSVLGSGFGSLNASKQAPA
PDIRTSEQLNGPRLGQRTSQMLATTSNSSISKDQGQSPMQAPAPAPSPSADNKAQRLENG
SVTAQHSEMKLQPEPSVVLSQLAQRQQQSTILPTTEPLGLVQAHAPQAPTPPGHESSVPP
VRDSASPGVKLPGMEPLTTEPPQRQIKTQRRRAAPPSKIPSSAVEMPGSADVSGLNVQFG
ALDFGSEASSGTSDMVPTELAREHTPVQAPTAMPVPTAIPTQPPQNSLFSKPGAVSEHMS
SLSSVTDPNFPSPSLGLPSATPSPSLGLPSAAAPPSSSAPTTVSRVESSVPRSLPPHLGF
SQSKDVPSAPGGPLTNGYTGMKTQSTQDGTASSRTVKTESPIMTSDSSPGHHIPSPAVTA
SHSTSISSLSSHTSSTHSSGSTLSTTSSLTTSNEESSSGNIHAFSSSSSSQVVNPNPSAP
PVVSNSATNGLHPSGAPGLIPNGTNTTLSAAGSRAAPLLTTTSGKAPPNLAQGVPPLLTN
QYIMGPGGLLPAYPQIYGYDELQMLQSRLPLDYYGVTFPGATTAMPGRDGLANNPYSGEA
TKFGRNDSSSPAPPTTLSTAGVQSQPQQTQQAGTQGQGQGQSQGQQTQNQAFLNPPLPPG
YGYTGLPYYAGMPGVPSAFQYAPTVFVPPASAKQPAMGLANPSNQYHQQHQPSYGQHAYG
TAFDDLSQAHGGEYSKAGYGSTAQSQAKSAGSGPGKAPGLSGSGTSGGVPDMGGSIYSKT
QSFDKQGFHTGTPPPFSLPSALGGTGPLNPGGAPGYAPAPFLHILPPHQQPHSQLLHHHL
TQDGQGGPGQRSQSSSMQQKTQGSKSSYSSSAYWAN
Download sequence
Identical sequences I3K692
ENSONIP00000016637 ENSONIP00000016637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]