SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016682 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016682
Domain Number 1 Region: 153-428
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-72
Family Protein kinases, catalytic subunit 0.000000693
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.6e-46
Family PB1 domain 0.0000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016682   Gene: ENSONIG00000013265   Transcript: ENSONIT00000016697
Sequence length 449
Comment pep:novel scaffold:Orenil1.0:GL831355.1:577894:638491:-1 gene:ENSONIG00000013265 transcript:ENSONIT00000016697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSLRLNTDSAMNTEAIVIRIKTPSGDMDSSVDCPSLLNFNDLLVAIRDVMPEATVTAFE
YEDEVGDRITVRSDEELKAMLSYYCNTMNEQRMNGLLPDPLQIFPRAGKTPGIRNIHGLK
VNTRPNPANDCSHAVPDSIANNSLKKSSAELKRILTNGQINAQDIHYQEQLGHGNGGTVY
KAYHVHGKRVLAVKVIPLDITVELQKQIMSELEILYKCDSPYIITFFSAFFVENRISICT
EFMDGGSLDVYKRIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGRVKLCD
FGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHADVWSAGISFMELALGMFPYPQIQK
NQGSLMPLQLLQCIVDEDPPVLPVSQFSEKFVHFITQCMRRNPKERPAPNNLMDHPFIIQ
YNDGNAEVVSMWVCRCLEERRAQLAQGRM
Download sequence
Identical sequences I3K6D7
ENSONIP00000016682 ENSONIP00000016682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]