SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016728 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016728
Domain Number 1 Region: 40-448
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 9.94e-85
Family Regulator of chromosome condensation RCC1 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016728   Gene: ENSONIG00000013300   Transcript: ENSONIT00000016743
Sequence length 451
Comment pep:novel scaffold:Orenil1.0:GL831267.1:1749286:1763907:-1 gene:ENSONIG00000013300 transcript:ENSONIT00000016743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFPSVRLCPRHMRAGLQVCWYATLSKASRPQEKSGSDPVFQYVGQHKKPTHKVFVWGFS
FTGALGIPTFVVPDSGRKKPRKYQLTPYRLETAEQISSAACGYGFTLIASPTKDVTKLWG
MGLNKDSQLGFQRTQHDRHKSYDYVLEPSPVALPLVEPLQTRVVQVACGRAHSLVLTDRE
GVFSMGNNAYGQCGRRIVEDEVYSGSHIIHKIEGFSGRVIQVACGQDHSLFLTETGKVFA
CGWGADGQTGLGHHNISSSPVEVGGDLAGVEVQQISTYGDCSLAVSKDGQLYGWGNSEYR
QLALVTQATQMNSPRHLPLKGCGKVVQAACGGTQVAILNDKGEVFVWGYGILGKGPKLSE
SSTPEMIPPTLFGRSEFNPSGVVSRIRCGLSHFAAVTDRGELFVWGKNVRGCLGIGKKDD
QYFPWRVTVPGQVVDVACGVDHMVALAKSLL
Download sequence
Identical sequences I3K6I3
XP_003453490.1.78416 XP_005458308.1.78416 ENSONIP00000016728 ENSONIP00000016728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]