SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016731 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000016731
Domain Number - Region: 60-184
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0157
Family HBL-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016731   Gene: ENSONIG00000013303   Transcript: ENSONIT00000016746
Sequence length 486
Comment pep:novel scaffold:Orenil1.0:GL831215.1:535813:541701:1 gene:ENSONIG00000013303 transcript:ENSONIT00000016746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METYHDQILDSPSKNSYIGSYYQPPDRIVQPSREPKPHAHSSVSMGTHMASSSVSQSRPN
IDSKAVVDALKTLQEKIRRLELERMQAEKSYQQFSHDAQKHPQVTTLYSQTAASLPGTDN
SARRELDSKLQSAEARCKVLEKQLDYMRKMVENAKKERSALMENQASLQSEQKSSSNSQI
QREKLEKLESECLKLSRTQTLAEMKLSILEQKLLKEEHERKLVQEKAEELQREFDVSLRP
SLPTSEETKPKKKTKKTIRKTSKPAELLPKSPMHKKMPFVAGTSTSPSHSVHANVQSILH
MMKHHQPQLCQRVSALHRSGCGVKKNLQKDFSSSSSDSSEKPNRLPVDPSLSSLADLLLA
LQDELGQMSFEHQELVRQIDGAQNPEQRQDLQRELEMLVTRMEDKGSQITKLRKHQRMIQ
KLAQCRSSPEEHTAKKLSGIKPPAPSPVKTEKKGRTDRTTQKNLQLLRETQKFRNSLKQD
DLSWET
Download sequence
Identical sequences I3K6I6
ENSONIP00000016731 XP_003449919.1.78416 ENSONIP00000016731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]