SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016829 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016829
Domain Number 1 Region: 14-119
Classification Level Classification E-value
Superfamily CAD & PB1 domains 9.03e-28
Family CAD domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016829   Gene: ENSONIG00000013389   Transcript: ENSONIT00000016844
Sequence length 212
Comment pep:novel scaffold:Orenil1.0:GL831249.1:71958:82204:-1 gene:ENSONIG00000013389 transcript:ENSONIT00000016844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAPLSIQSGVKYAKTLLPKTLMRSMSTVQTTISRHMLPLNRPRCFRVCTYSRMRRRSLT
ASSLDELLEQAARVFMMSYQFLTLVLEEDGTVVDSEEFFQSLPNSTPLMVLEKGEMWTES
KIIPCFRQPKKSGIAKVTFDLYKLQPKDFLCCLAIRATLYETYTLSYDFRFTRIKRILSS
LLCCVTSLTRLAGQLLLCTSSSLLQFTGNAGC
Download sequence
Identical sequences I3K6T4
ENSONIP00000016829 XP_003452419.2.78416 ENSONIP00000016829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]