SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000016906 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000016906
Domain Number 1 Region: 588-650,911-1030
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.62e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0055
Further Details:      
 
Domain Number 2 Region: 8-199
Classification Level Classification E-value
Superfamily RUN domain-like 1.83e-33
Family RUN domain 0.00074
Further Details:      
 
Domain Number 3 Region: 1007-1128
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000016906
Domain Number - Region: 242-307
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0709
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000016906   Gene: ENSONIG00000013445   Transcript: ENSONIT00000016921
Sequence length 1137
Comment pep:novel scaffold:Orenil1.0:GL831238.1:1503194:1536973:-1 gene:ENSONIG00000013445 transcript:ENSONIT00000016921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIMAEAETRQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRR
AAGFLRSNKIAALFTKVGKSFPPAEELCRKAQELEQIIETKRSQSLQSQDSIRKMPRLPS
LSPPVVKNLWIRTALFEKVLDKIVLYLVENSSKYYEKEAVLMDPVDGPILASLLVGPCAL
EYTKMKTADHFWTDPSADELVQRHRIHGGLCRQDSPTKRPALCIQKRHSSSSMDERPSPS
PSAREYVESLHQNNRATLLFGKNNVLVQPRDDMEAIPGYLSLHQTAELMTLKWTPNQLMN
GSVGDLEYERSVYWDYAMTIPLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPLRFPKGGH
LLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRVPQGSGSSDSVSDKEEDEATDY
VFRILFANSQSEFESPSLTGSSCNTVTLWLVCPSVNSGQLIKHGNRIEKGACLIELPPYI
NVITPPDLMDPGAKMWHPTLRKSSCSSCSQGSFSEAATPKGCNHERTPLKLLCDNMKYQI
ISRAFYGWLAYCRHLSTVRTHLSALVNHTIVAPDVPCAASGGLTADVWQTFLKDCTAYKE
QELLRLVYFGGVDPSLRKEVWPFLLGHYQFGMSEAERKEVDDQVRVCYQQTMGEWLSCEE
IVRQREKEQHAAALAKCSSGASMDSYSQKMKHHDSTVSNESSQSSDRQSLARLQSDSSSS
TQVFESVEEVDQIEMEPKNGETKQVPKLPNGALQNGTSSPDSGHPSSRNFSITSGLSDGS
FSTEDSAAQDTTPRPAAVPQVSQSSVKPAGGESEGQSLEKDGQVEGEKDEPHIMTESDES
PSAIEMEEIPKAKVSMVPWSRQKEEQRKLSPEGTESNLSEPEMESLYPPFDSLAASENTK
NQVTSQVSTGSPFSQELLDLYTLNLHRIEKDVQRCDRNYWYFTPANLEKLRNIMCSYIWR
HLDIGYVQGMCDLLAPLLVILDDEAMAFSCFTELMKRMNQNFPHGGAMDTHFANMRSLIQ
ILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFAVWETIWAAKHVSSSHFVLF
IALALVEVYRDIILENNMDFTDIIKFFNEMAERHNIKQILTLARDLVCKVQMLIENK
Download sequence
Identical sequences I3K711
ENSONIP00000016906 ENSONIP00000016906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]