SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017117 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017117
Domain Number 1 Region: 105-154
Classification Level Classification E-value
Superfamily UBA-like 0.0000373
Family UBA domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017117   Gene: ENSONIG00000013609   Transcript: ENSONIT00000017132
Sequence length 165
Comment pep:novel scaffold:Orenil1.0:GL831735.1:8332:15293:1 gene:ENSONIG00000013609 transcript:ENSONIT00000017132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDTLNSCPPSQPPPPPPPARHSFTEPPSSSSSYMPPSGHEHVLLTPDSVFGMVNSAAPPH
PAKRQTDNVKDSRGILEYNHPVSLDCLQAPARPPKPYPRKIPPEIQPEKPHSLVLESEDA
KIAKLMGEGFAFDDVKRALMIAQYKVDVARNILREFALVAPRLNL
Download sequence
Identical sequences I3K7M2
ENSONIP00000017117 ENSONIP00000017117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]