SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017189 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017189
Domain Number 1 Region: 136-249
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-37
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 2 Region: 38-133
Classification Level Classification E-value
Superfamily C-type lectin-like 2.23e-37
Family Link domain 0.00000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017189   Gene: ENSONIG00000013664   Transcript: ENSONIT00000017204
Sequence length 266
Comment pep:novel scaffold:Orenil1.0:GL831337.1:35853:43328:-1 gene:ENSONIG00000013664 transcript:ENSONIT00000017204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLALLWILGFVLKEVEAWSYSNGIFHNSIWLEQAAGVYHRESRKGRYQLTYKEAKAVC
KYEGGTLATYEQLEAARQIGFHVCAAGWFDKGRVGYPIVKPGSNCGFGKVGIIDYGYRLN
KSERWDVYCYNPNSKECGGVLTEQQKIIQSPGFPEEYEDEQICYWHIRVRLGQKIRLHFM
EFDVEDDTECLADYLEVYDSYDDVSGFAGRFCGDYLPDDIISTGNVMTLKFLSDASVTAG
GFQLQYIAFNASLPHKKNNDTLYSIL
Download sequence
Identical sequences I3K7U4
ENSONIP00000017189 ENSONIP00000017189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]