SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017315 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017315
Domain Number 1 Region: 269-427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-50
Family SPRY domain 0.00013
Further Details:      
 
Domain Number 2 Region: 32-99
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-18
Family RING finger domain, C3HC4 0.0083
Further Details:      
 
Domain Number 3 Region: 119-175
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000113
Family B-box zinc-binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000017315
Domain Number - Region: 156-268
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0207
Family HBL-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017315   Gene: ENSONIG00000013765   Transcript: ENSONIT00000017330
Sequence length 427
Comment pep:novel scaffold:Orenil1.0:GL831164.1:128899:131445:1 gene:ENSONIG00000013765 transcript:ENSONIT00000017330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVHYSPSRKKVQETYFGELKILKDQMAERALFENFLSCHVCSETFRDPVSLTCNHSFCSS
CLQQFWEQTKNKNCPVCKRKSSKDRPDVNFALKELADSFSGRKKPGSSETEKRDTELTVV
CSKHEEVPKLFCVDEQRAVCPVCDFSLHQSHKVVPVEEAVSDLKEQLKFDLKSLQDKRNK
YKQVEETYNEVIQHSKKQLLSTERQIRAEFNKLQQFLKEEEESRLAALREEEEQKGRTIS
REMKMIEEQISSLSDSISAVEEELQKHSVPFLSPVILDPNTASGWLYLSDDLTSVRHGDT
KQQLPDNLERNTKYVTVFGSEGFSSGKHSWEVQVGDDPDWNMGLVKESVDRKGECPASTK
YGRWCLMHRSGKYINGVGQTVTVKKSLQRIRVQLDYDRGEVSFYDPEDMTHICTHRDTFT
EKLFPYF
Download sequence
Identical sequences I3K870
ENSONIP00000017315 ENSONIP00000017315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]