SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017317 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017317
Domain Number 1 Region: 200-365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-54
Family SPRY domain 0.00014
Further Details:      
 
Domain Number 2 Region: 14-84
Classification Level Classification E-value
Superfamily RING/U-box 2.91e-19
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 102-165
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0000981
Family Tubulin chaperone cofactor A 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017317   Gene: ENSONIG00000013767   Transcript: ENSONIT00000017332
Sequence length 381
Comment pep:novel scaffold:Orenil1.0:GL831164.1:176758:178299:1 gene:ENSONIG00000013767 transcript:ENSONIT00000017332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLKTEKMAEKETFLKSYLSCHVCSETFIDPVSLNCKHSFCLNCLQKFWEQANNRNCPICK
RKSSKEDLRVNFVLKELADSFEQQSHKLVPVEEAVSVLKKHLKSDLKSLQDKRNKYKQMV
KTYNEVIQHSKKQLLSTERQIRAEFNKLQQFLKEEXDTQSRARAQSSVSDPQLVSGALID
VAKHLGNLSFRVWEKMKEKVHFSPVILDPNTAHCCLYLSDDLTSVTYGNTKQQLPDNPER
NTKYSNVLGSESYSSGKHSWEVEVGDHPSWNLGLSKETADKKGECSASPKNGIWCLVHRG
GKYNNGAGQIVNVTKHFQRIRVQLDYDTGQVSFYDPEDMTHIYTHRDTFTEKLCPYFCIF
NAGNAKTGFSLLILTVDKYCL
Download sequence
Identical sequences I3K872
ENSONIP00000017317 ENSONIP00000017317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]