SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017391 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017391
Domain Number 1 Region: 553-812
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-93
Family Eukaryotic proteases 0.000054
Further Details:      
 
Domain Number 2 Region: 77-167
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000000157
Family SEA domain 0.0047
Further Details:      
 
Domain Number 3 Region: 346-453
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000144
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 4 Region: 228-336
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000196
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 5 Region: 459-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000916
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 6 Region: 494-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000301
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017391   Gene: ENSONIG00000013831   Transcript: ENSONIT00000017406
Sequence length 813
Comment pep:novel scaffold:Orenil1.0:GL831535.1:34522:55463:1 gene:ENSONIG00000013831 transcript:ENSONIT00000017406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGHGSKKSISCDQGITDVSLSNGVGAATQTVAPPTRKSRSCKCKCVLAFLIILIVILI
VAAAILAWYFLEYKVWVLEARVQQQYTAYLSILNRNFSTDLSSHNSPVFKKEAKGVERMV
ENIMKGSSLSRYFNCTTVFAFGEGSVVAHFWIMLNIPSSHADGVTLEKVSRSLVEGLKGY
SRSKVVYMLNFEMILKCFERGLIIRLLTSANSIWVLSECLNCYRYQKVVSSSPVLLRGPN
TQRSSCLWHLQTTPGSQLELHMEWLLPECSDRLLVYNSLTPADNHLITSVYGCSRHEHVV
RVLSSGEWMTVVWKQGLYNYKESFSLSVQAWEHHDCNSTIQLEAVSGVQGTLKTPFFPSY
YPPDTNCTWSFTMPSAGMGLCLTFEGYELSRASYNQACTQGQWVIQNRRLCGTRALQPYS
ERLFLLSMTTTIFMTSEVSLTGPGLQLQYSVFNLSDPCPGQFLCTVNGLCVPICDGIKDC
PNGLDERNCVCVAQYKCPEDSQCVDYYKVCDQHPDCPEATDEMNCTEGVQCTDMTYVCAD
GTCLKKPNPECDFVTDCPDASDEKHCECGLRQFSSRIVGGTDASEGEWPWQASLQVRGNH
ICGGALIASQWVLSAAHCFYDDRLYSPSVWTVYLGKLLLNRSSPTEEVARVQRIHLHHYY
DDESHDYDLALLKLDRPAAALLAGHARPTCLPPPTHQLEPGLLCWVTGWGALREGGTASN
VLQKVDVRLVSEESCIRSYGHLVTPRMLCAGYRNGGKDACQGDSGGPLVCQEPSGRWFLA
GVVSWGRGCGRPDYYGVYTRITRLTNWIKQVIS
Download sequence
Identical sequences I3K8E6
ENSONIP00000017391 ENSONIP00000017391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]