SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017449 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017449
Domain Number 1 Region: 43-258,293-356
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.89e-16
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 2 Region: 851-951,1130-1198
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0000589
Family Regulator of chromosome condensation RCC1 0.025
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000017449
Domain Number - Region: 1089-1354
Classification Level Classification E-value
Superfamily NHL repeat 0.000942
Family NHL repeat 0.029
Further Details:      
 
Domain Number - Region: 777-826,950-1118
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0326
Family Quinohemoprotein amine dehydrogenase B chain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017449   Gene: ENSONIG00000013878   Transcript: ENSONIT00000017464
Sequence length 1363
Comment pep:novel scaffold:Orenil1.0:GL831913.1:9062:31812:-1 gene:ENSONIG00000013878 transcript:ENSONIT00000017464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHLGSNMAAQLAPQSVLREFCPLYYLLNAIPAKVQRGFRSVLVYLTALDSSSDFLAVGSS
IGMLYLYCRRLAHLNKYSLEGKYDAITAVKLLSCFDDLVAVGTSSGRVAVFQLVSPLPGR
NKQLRRFNVVGLHKGSVTALAWSTNGMKLFSGDDKGRVVFTSLDLDQGVCKPVLLLEESS
GVVQMEYSHQVLLVSTQQRSLLYCTQKQEVLQLGTKPRKSSGRFGACFLPALCKQSDLQV
FAARPGLRLWRSDIRGQVEDTRLLKPLFNSQIPQFELFPRPDPIGGYRPADRQLGLLRCF
LKEGWILSWNEYSIYVLDCLNQVIIGALESSGDIVSVSCCDNEIFVLKGDRDIIRLSNSP
EGLASNLLDLSVCLSSPLTTPTILRSVGSVEIAQPIRTMAIITEFASSSRSRSSSVTSWD
GLHGNAPASSSCELTSRRYSAPLGQEQMQQELVVKPIRVKKKKRRRQDSGGATRVSESSC
SDSMFVVQDGSVSDGGSGTPLSDRASLVGVDFQNENSPEHHPNQGPWKTKVSERGMKEEE
EVEASSHQTGSLLLLGLENQPDPGAEVVPPTPDVDLLLECTFSYMQNTEEAEEFPDRQPV
EADEFLSPLIGPEEEELKVLTNIHEHVTCPPTFPGITPAQSSPVFWQDVSVRVSISNGIS
INKVLTGQGLSLKLVCGSACLAQVKDDVLAPSAGMTDQMFHSTVSNLDRKHSLPSDEDDD
IYSHTLPPAGNAVDTLTCLTNPTENSQDQDGQERDRLKPEQLAESWMGYSGPGCGILSLQ
VTDRYVWCLDFKGGLFCSPLPETGLTWQRFEDNVHQMALSPSGNLLWKVEQKSLTAFACA
KFSAKGKRHWYKAVEQAAFVALSDDSAWIIRTNGDLFLQTGLSVERPCARSIKVETPCVF
SQVCVRAGVVWALSEHQALFYREGLNSYCSEGEGWKYDTVSDSSQLEALYTVHLGDGGTA
WALDASGSLWFRTGVCLSRPQGEDDHWWQISISDYVVFDQGSLFQTLLQATQSVATVTRA
PVERVVAFLSQYSQCQPSLVSANASGVWVASGRNQLHLARGSLVGTFWQNVVPRGTVSAT
RWTFITSSAVPHREGTFLWLAQSRKDLFCVWDQDGELRPSSVLLPPEVELTHLSACRDAL
WGLDTHGRVSIRTLSPSCPAGLHWTPLDLSQLGSVRLVSVSCGSQNVWAVDSRGVVYFRV
GTQPLNPSMMLPAWIQIEPPVQPIGVQLMSIQTSPNDRLLWALDNRGSVFVRTGLSDEMP
VGTEWELVPGTHSCRTAWVRCVNGDLARRYGVSERNPAGDYWKKIPGNASWFTVTPEDEL
WAVTQLGGLSHRLTKLLPQTPLRPPPSSPALGGDDVDDEWELI
Download sequence
Identical sequences I3K8K4
ENSONIP00000017449 ENSONIP00000017449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]