SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017709 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017709
Domain Number 1 Region: 450-509
Classification Level Classification E-value
Superfamily UBA-like 7.14e-17
Family CUE domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017709   Gene: ENSONIG00000014089   Transcript: ENSONIT00000017724
Sequence length 740
Comment pep:novel scaffold:Orenil1.0:GL831164.1:3652127:3663701:-1 gene:ENSONIG00000014089 transcript:ENSONIT00000017724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACARVPLDEQQVTEPGPLGKERTLPALHPDRTEERCFVPYKPPPEDGSPADVEEFLEHA
RFITEDLEWLLALPHDKFWCQVVFDESLQRCLDSYLRHAPRGLDLSTLPSSPAVADMQRS
IHKAVFLTFLRMATHKESKGNGQLLHKMIENIFTQQPSYYNDLDETVPTVLQVFDTILEK
CGLQCEGATAAEPMKLNAHKKPTAMTMSQQELLDIILYLCDSTTTINAFLDIFPAACSSF
QSHGFLSSLTSFYETGVPDLEKAIRKRNFDDKSLQEDLWKRLSHSCRKMVETVHLLLHHT
CLQPILEGRENMQTFAEELLQYFTSFLPEKRFLTDYDEQFPVADDISLLQQAVPIIDETR
TSYLLQGVESAWDSVGRRKPQSQIQTSQAQASASLSANQGPAPGAAASSLAGSKPQEVRE
PAEGESPRGAEAMLDVPQRGNNGAMCPVIGAELESLLSCIRDLLPDLGEGFLLECLKEYN
YNSELVINDILEDRLAPSLAKLDRTMPRPVKEELPAVLNNRSNVFDGDEFDVFRREQVDM
SRIWKGRRKGENVREMLNDKRHVAEQKARYHAYETVVDEVIVEPGESATAYELDDYDDEY
DDTYDMNQVGANDLDGDSLLTRRPFTVPQVLRKANKEDEEDEDEDGQEEDASKGAVNRDQ
FVQDPAVLRERAEARRAAMQQRKGFRPERSSNVVGRPKGQGQTTETLLDRRKKETNKSRG
ANHNRRSMADRKRNKGMIPS
Download sequence
Identical sequences I3K9B4
ENSONIP00000017709 ENSONIP00000017709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]