SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017759 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017759
Domain Number 1 Region: 68-231
Classification Level Classification E-value
Superfamily RUN domain-like 2.75e-52
Family RUN domain 0.0000000464
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000017759
Domain Number - Region: 266-470
Classification Level Classification E-value
Superfamily Tropomyosin 0.000111
Family Tropomyosin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017759   Gene: ENSONIG00000014125   Transcript: ENSONIT00000017774
Sequence length 473
Comment pep:novel scaffold:Orenil1.0:GL831164.1:3863512:3872712:-1 gene:ENSONIG00000014125 transcript:ENSONIT00000017774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLTPQSETPTPTTDKITQAARETIYLCNFRVSVDGEWLCLRELNDISLTPDPEPVHED
PKDPIAIERLNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKTKK
TFLGQNKSFWGPLELVEKLTPEAGEITASVKDLPGLKTPLGRGRAWLRLALMQKKLSDYM
KTIINRKDLLSEFYEPNALMMEEEGAVIAGLLVGLNVIDANLCMKGEDLDSQVGVIDFSM
YLKDGGHSSKSVEGDGQITAILDQKNYVEELNRHLSASVNNLQAKVDALEKSNTKLTEEL
AVANNRIITLQEDVERVKEESSYQLESRKALRSDSAADGQALGETRKQLKEETLLRLDVE
KELEVQIGMKQEMELSMKMLEKDVCEKQDALVELRQQLEDLRAINQQLMHKSQSADASSK
QKSEVIVRMEEKINQMSGTIKQLETRKKISDKHLVKQARNLNSAAGKLLQLQQ
Download sequence
Identical sequences I3K9G4
ENSONIP00000017759 ENSONIP00000017759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]