SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017799 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017799
Domain Number 1 Region: 482-743
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.24e-91
Family Eukaryotic proteases 0.0000124
Further Details:      
 
Domain Number 2 Region: 227-336
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-25
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 3 Region: 128-223
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000116
Family Spermadhesin, CUB domain 0.009
Further Details:      
 
Domain Number 4 Region: 341-375
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000124
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 420-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 6 Region: 455-494
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000182
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017799   Gene: ENSONIG00000014158   Transcript: ENSONIT00000017814
Sequence length 744
Comment pep:novel scaffold:Orenil1.0:GL831157.1:575331:582968:-1 gene:ENSONIG00000014158 transcript:ENSONIT00000017814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSPVFVSLASLRQQEQFSDLYKSFPWSPYHVRSGITAFSEGAEGLTVFYWSKFSAPDNVA
MEIQTSGPERLQRRLPGSNKLDTLILLKFPAFPCKYTENQKGQSTTMSFDLYAKYGNNRT
LSLVSPKKPYYQWRLRVPSGHVVRLVVLTLHGATPGSCTAHKLSAYDFLLPLQNKIIARW
CGLPISGSSPVMKLTSSGNVMLVTFSFSRQRDGAIFKAYFQAIPKAGCGGSISSWNGSIS
SPYYPSYYPPNIDCIWTLRVPLPGYLISVTIVTMDIQDSPSSDGCEKDWLDVGGVKLCNP
VSDSSKKRVQSSPLTLHFHSDESLTNKGFYLLYRAFAPEGTCPRQFRCGDSRCIPLKKVC
DGVKDCSDGRDEAKCSSCKPGELLCGNNQCKPQSQCVSQSICADSSEEGGCVCFSGGKCY
HVCPNKVCLSKSSVCDGVIDCKDRSDELNCTRAYVKGCSSSSYKCANGKCVSKVNPECDG
VKDCYDGSDELRCGCGTRPKKRTKIVGGSDAVAGSWPWQVSLQMDRYGHVCGATLVSNRW
LISAAHCFQDSDAIKYSDARAWRAYMGMRVMTTGNQGAATRPIRRILLHPQYDQFTSDYD
IALLELSAPVFFSDLVQPVCVPSSSHTFTTGTSCYVTGWGVLMEDGELASRLQEASVKII
NRSTCNKLYDDAVTPRMLCAGNLQGGVDACQGDSGGPLVCLERGRRWFLAGIVSWGEGCA
RQNRPGVYTQVVKFTDWIRQQTKG
Download sequence
Identical sequences I3K9K4
ENSONIP00000017799 ENSONIP00000017799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]