SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017806 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017806
Domain Number 1 Region: 600-837
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.88e-82
Family Eukaryotic proteases 0.0000689
Further Details:      
 
Domain Number 2 Region: 92-226
Classification Level Classification E-value
Superfamily SEA domain 1.57e-24
Family SEA domain 0.0084
Further Details:      
 
Domain Number 3 Region: 259-347
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000824
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 
Domain Number 4 Region: 472-509
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 368-467
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000017
Family Spermadhesin, CUB domain 0.0083
Further Details:      
 
Domain Number 6 Region: 507-543
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000107
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 7 Region: 547-586
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017806   Gene: ENSONIG00000014165   Transcript: ENSONIT00000017821
Sequence length 837
Comment pep:novel scaffold:Orenil1.0:GL831157.1:584916:596335:-1 gene:ENSONIG00000014165 transcript:ENSONIT00000017821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAQHDENKQTSGDDDDASRQDCASIADVSVEVATVDHTLQKLCRKYRKTRRKPKGLKRL
WLRLLNIPHISVIITAVVFVMVVIMWSLLWVFIFRRESNNGAYFAGMFRVANVEFIPEYR
QAESHEFVSMANKIQHVVNNVYKMSSVAKLYKQAVISDLSNNNKGGVLVHFWMAFVVPRL
KSSEMCEECLAAIFRDSVHTSLNRSSIGYLLGLPVDIDSILINGVQRSDYSSNTADSQCV
DKMYANLPGVTVPLSVFSSWGGINCHVKLTAVPGSLIRLTITSFVIEPSDCVNDALTVYD
ALLPMRGRILHSLCEPVSSAVSIVATSNFMLLSFRMTDGKKNFRGYFEAIAEEVCMSQIE
TQLEPGIRDRIYSPFYPSMLPPQCSCTWKFKTQNSTLGVALHFHNYVLKPKDMNGCDQGW
WKVNEVIYCGSYVGHNTVFRIADYNPEVEFRCSSRTSAQPFQASYSSYSMNQPCPESHFL
CNTGLCVQKTRLCDGLDDCQDESDEVFCSRPTMSCGANSPLHPLLVCNGETDCTDGVDEL
NCTQETTCSAIRYQCKSGSCILKKNAKCDRVDDCRDRSDEADCACGRPSPLTRVFASTGF
ERIVGGANSAEGEWPWQVSLHFAGNLYCGASVLSPDWLVSAAHCFNKQRLSDPRYWSAHL
GMLTQGSAKYVADIQRIVVHEYYNAQTFDYDIALLQLKKPWPPSLSPLVQPVCLPPSSHT
VTDSHRCVVTGWGYKTEDDKVLPSVLQKAEVSVMSQTECKKRYGIISPRMLCAGVPSGAR
DACRGDSGGPLSCQAPGGGRWFLIGIVSWGSGCGRPNLPGVYSRVTKFTSWIYSHIR
Download sequence
Identical sequences I3K9L1
XP_005471914.1.78416 ENSONIP00000017806 ENSONIP00000017806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]