SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017840 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017840
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily UBA-like 0.00000000158
Family TAP-C domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017840   Gene: ENSONIG00000014193   Transcript: ENSONIT00000017855
Sequence length 259
Comment pep:novel scaffold:Orenil1.0:GL831258.1:305572:308454:-1 gene:ENSONIG00000014193 transcript:ENSONIT00000017855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHKLKSSQRDKVRQFMSFTQAGEKTAVYCLTQNDWKLEVATDNYFQNPELYCKESMKTSV
DRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFTKK
EFMDGMTELGCDSPEKLKALLPRLEQELKDSGKFKDFYQFTFNFAKNPGQKGLDLEMAVA
YWNLVLSGRFKFLDLWNRFLLEHHKRSIPKDTWNLLLDFGNMIADDMSNYDEEGAWPVLI
DDFVEFARPIVTGSKRKTL
Download sequence
Identical sequences I3K9P5
ENSONIP00000017840 ENSONIP00000017840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]