SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000017847 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000017847
Domain Number 1 Region: 21-70
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 7.32e-19
Family Cysteine-rich DNA binding domain, (DM domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 229-279
Classification Level Classification E-value
Superfamily UBA-like 0.000000158
Family UBA domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000017847   Gene: ENSONIG00000014199   Transcript: ENSONIT00000017862
Sequence length 470
Comment pep:novel scaffold:Orenil1.0:GL831164.1:4423952:4427504:-1 gene:ENSONIG00000014199 transcript:ENSONIT00000017862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYGSPYLYMGTPVSQPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILI
IERQRVMAAQVALRRQQANESLESLIPESLRVLPGIGLAGTGEGNQPAPPRTEELELRWS
STEPGQPGAPLCSEPTEDGADEVSAGENGESSSEKEQDAVSSPEASKPNCYTPEPPGTPS
LPEESRYGLPKAGSAEKEAKAESPQKYPASPAEQGVLIEGLGGSITLPLSLRANRPPLEV
LKKIFPAHKPPVLELILRGCGGDLVGAIEVLLSSRNPDASAPPHADVHADALVLPSNGHL
FEPGLGSYHPASSSAKWSVGSAFRVPDSLRFTSDSAAGVVSTGALGVPLQHPSFPQPTRY
PLMLRSSLTRSHAGPFVHNDVTLWNSVALQQQYQLRSAAQYVSPFPPGAPGGPGLFRGSP
LLPSRPSEEPRVGIQEEGCPLGPKPGLYSPDEEYEERSDSADSRILNSSS
Download sequence
Identical sequences I3K9Q2
ENSONIP00000017847 ENSONIP00000017847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]