SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018033 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018033
Domain Number 1 Region: 50-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-32
Family Spermadhesin, CUB domain 0.00014
Further Details:      
 
Domain Number 2 Region: 169-292
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-18
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 3 Region: 290-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018033   Gene: ENSONIG00000014342   Transcript: ENSONIT00000018048
Sequence length 554
Comment pep:novel scaffold:Orenil1.0:GL831157.1:2377783:2444552:1 gene:ENSONIG00000014342 transcript:ENSONIT00000018048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHGHSFHHVVASLLILGLCGATKKDTAVKNNSGVKPAGQCGTWVKEAEGGLFTSPNYPN
KYPPDTECVYILEAPPRQCIDLHFEENYSIESSWECKFDNIEVRDGPFGFSPILGRYCGQ
HSPPDIRSSGRYLWIKFVTDGELEAVGFSANYNFTADPDFADLGIPPPLPSCQYDMVGPE
GIVESHQITRDGKAGATEAVDCKWYIRAPPRSKIYLRFLDYEMANSNECKRNFVAVYDGG
SSVEDLKSKFCSTVANDIMLVSTLGVIRMWADEASRKSRFRILFTTYQEPPCDADAFFCH
SNMCINNTLVCNGMQNCVYPWDENQCKEKRKANILDNLNNTNGTIIGVTCCIVFILLIIS
VIVQIKQPRKKYILRREDFDPTMFQEVFEPPHYELCTLRSATTPTAASADLVDLAEDFEN
YHALRRASSRCVHDHHCGSSSNPGSAHISQLSLSGRGSRGNLSARDAAAATLLTDLPQPS
MAVRPLLPATGNRRSILVMKHSYSQEAADNGCDLDDDLEEVPTTSHRLSRHEKAVQRFCL
IGSLSKHESEYNTT
Download sequence
Identical sequences I3KA88
ENSONIP00000018033 ENSONIP00000018033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]