SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018178 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018178
Domain Number 1 Region: 56-170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000432
Family Spermadhesin, CUB domain 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000018178
Domain Number - Region: 178-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0641
Family Spermadhesin, CUB domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018178   Gene: ENSONIG00000014458   Transcript: ENSONIT00000018195
Sequence length 322
Comment pep:novel scaffold:Orenil1.0:GL831230.1:1994344:2001842:-1 gene:ENSONIG00000014458 transcript:ENSONIT00000018195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVALRTQLFLFLISVSLRMGLARYIEDNEASDGLYSLLSLAQKRESEDFIFRRPLRCLD
MLATDGLFTFVASKPQLACAAFIIAEPSEVISLELSDVSIDCSAGDFIKIFDGWVLKGEK
FPSNQDHPLPLYERYTDYCSSTAPGATSRSSQNVAMIFFRIHSPDSGFTLAVKKLHNPFP
CNIMSQSPEGSFTMVMPHQRKNCSFSIIYPVEIRLTELSLGQAKSNELSPQRLAWSGCSG
SGDYVELLGGNGVDTSKMFPVADLCFSLSGLAQMKIGCDNSVVRLVSSGNYINRVSFQYR
LLEHNELPKARENSLENFCTVE
Download sequence
Identical sequences I3KAN3
XP_003451100.1.78416 ENSONIP00000018178 ENSONIP00000018178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]