SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018404 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018404
Domain Number 1 Region: 153-250,280-360
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.15e-49
Family Regulator of chromosome condensation RCC1 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018404   Gene: ENSONIG00000014619   Transcript: ENSONIT00000018421
Sequence length 368
Comment pep:novel scaffold:Orenil1.0:GL831142.1:2082802:2084656:1 gene:ENSONIG00000014619 transcript:ENSONIT00000018421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWFGFGFNAFGQIRVQEKSGRGESSSALHQVKVTHPAELSSHVDKSGCCLKTSQIRVSW
SRRASLHLDGFGESVSSEDCGISKIESYGCKDVFISESHLTLAFPDRIETWDLQKREKSP
SWSMDIKTHAEGSDVNLPLVPGGYIALKPPLYCTLPGHLKARSLALGAEHAVLLTATGAV
YSWGLGSHGQLGHGVLTSEEEPRVVEALWGMSMTRVATGGWHSACISDGGDLYVWGWNES
GQLGLPSRGLRKSQQKSSQQTADEKLKEEEEHEDVFISIQAFPALLDVSPSCEIQTVSCG
SRHTAAVTTTGDLYTWGWGEYGQLGHQTVTSSDEPQRVEFFRAEQMRVLDVVCGTWNTFA
AAVKEEVA
Download sequence
Identical sequences I3KBA9
ENSONIP00000018404 ENSONIP00000018404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]